StarFunc result for job id Q9P2W1

User Input

>input (217 residues)
MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKI
KEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSA
LTTPEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMA
TELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A158RUX1	0.461	0.461	4.382E-34	217	1.000	1.000	A0A158RUX1.pdb.gz	A0A158RUX1_HUMAN Homologous-pairing protein 2 homolog OS=Homo sapiens OX=9606 GN=PSMC3IP PE=2 SV=1
2	AFDB:Q91ZY6	0.883	0.883	4.340E-31	217	0.880	0.880	Q91ZY6.pdb.gz	HOP2_RAT Homologous-pairing protein 2 homolog OS=Rattus norvegicus OX=10116 GN=Psmc3ip PE=1 SV=1
3	AFDB:Q9FX64	0.654	0.633	2.667E-16	226	0.341	0.327	Q9FX64.pdb.gz	HOP2_ARATH Homologous-pairing protein 2 homolog OS=Arabidopsis thaliana OX=3702 GN=HOP2 PE=1 SV=1
4	AFDB:Q9HGK2	0.449	0.451	5.033E-12	216	0.258	0.259	Q9HGK2.pdb.gz	HOP2_SCHPO Homologous-pairing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=meu13 PE=1 SV=1
5	AFDB:Q585V2	0.438	0.425	1.514E-9	228	0.230	0.219	Q585V2.pdb.gz	Q585V2_TRYB2 Homologous-pairing protein 2 winged helix domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.45 PE=3 SV=1
6	AFDB:P53187	0.331	0.335	1.860E-8	214	0.203	0.206	P53187.pdb.gz	HOP2_YEAST Homologous-pairing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOP2 PE=1 SV=4
7	AFDB:Q9BWT6	0.297	0.314	2.185E-6	205	0.138	0.146	Q9BWT6.pdb.gz	MND1_HUMAN Meiotic nuclear division protein 1 homolog OS=Homo sapiens OX=9606 GN=MND1 PE=1 SV=1
8	AFDB:Q09739	0.291	0.300	8.155E-6	210	0.161	0.167	Q09739.pdb.gz	MCP7_SCHPO Meiotic coiled-coil protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcp7 PE=1 SV=1
9	AFDB:P53102	0.294	0.291	2.368E-5	219	0.138	0.137	P53102.pdb.gz	MND1_YEAST Meiotic nuclear division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MND1 PE=1 SV=2
10	AFDB:Q385K1	0.283	0.172	8.300E-5	371	0.143	0.084	Q385K1.pdb.gz	Q385K1_TRYB2 Mnd1 HTH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3380 PE=4 SV=1
11	PDB:2o03A	0.298	0.476	1.350E-3	129	0.074	0.124	2o03A.pdb.gz	Crystal structure and function of the zinc uptake regulator FurB from Mycobacterium tuberculosis.
12	PDB:6h1cB	0.278	0.441	1.350E-3	134	0.101	0.164	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
13	PDB:4etsB	0.272	0.386	1.967E-3	149	0.060	0.087	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
14	PDB:1xsdA	0.264	0.443	2.865E-3	125	0.074	0.128	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
15	PDB:5hs7A	0.250	0.498	2.865E-3	102	0.078	0.167	5hs7A.pdb.gz
16	PDB:2fe3B	0.275	0.408	3.248E-3	143	0.069	0.105	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
17	PDB:2g9wA	0.258	0.453	5.038E-3	119	0.083	0.151	2g9wA.pdb.gz
18	PDB:7vo0G	0.253	0.402	5.038E-3	131	0.088	0.145	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
19	PDB:3m8eA	0.220	0.437	5.711E-3	101	0.083	0.178	3m8eA.pdb.gz
20	PDB:1r1uC	0.223	0.439	6.474E-3	98	0.078	0.173	1r1uC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A158RUX1	1.36e-161	446	217	1.000	1.000	A0A158RUX1_HUMAN Homologous-pairing protein 2 homolog OS=Homo sapiens OX=9606 GN=PSMC3IP PE=2 SV=1
2	Q9P2W1	1.36e-161	446	217	1.000	1.000	HOP2_HUMAN Homologous-pairing protein 2 homolog OS=Homo sapiens OX=9606 GN=PSMC3IP PE=1 SV=1
3	Q91ZY6	1.57e-142	398	217	0.880	0.880	HOP2_RAT Homologous-pairing protein 2 homolog OS=Rattus norvegicus OX=10116 GN=Psmc3ip PE=1 SV=1
4	K7ERB6	1.70e-112	320	154	0.710	1.000	K7ERB6_HUMAN PSMC3 interacting protein OS=Homo sapiens OX=9606 GN=PSMC3IP PE=1 SV=1
5	Q9FX64	1.74e-34	124	226	0.346	0.332	HOP2_ARATH Homologous-pairing protein 2 homolog OS=Arabidopsis thaliana OX=3702 GN=HOP2 PE=1 SV=1
6	Q9HGK2	3.32e-16	76.3	216	0.263	0.264	HOP2_SCHPO Homologous-pairing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=meu13 PE=1 SV=1
7	Q585V2	3.09e-09	57.4	228	0.249	0.237	Q585V2_TRYB2 Homologous-pairing protein 2 winged helix domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.45 PE=3 SV=1
8	P53187	9.77e-07	50.1	214	0.230	0.234	HOP2_YEAST Homologous-pairing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOP2 PE=1 SV=4
9	Q5AAV6	0.62	33.5	978	0.083	0.018	Q5AAV6_CANAL Put3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PUT3 PE=4 SV=1
10	P49454	1.9	32.0	3114	0.152	0.011	CENPF_HUMAN Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3
11	Q9TZA6	2.1	31.2	220	0.078	0.077	Q9TZA6_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C40A11.7 PE=1 SV=1
12	Q9DCW2	2.2	31.6	307	0.106	0.075	PLS2_MOUSE Phospholipid scramblase 2 OS=Mus musculus OX=10090 GN=Plscr2 PE=1 SV=3
13	Q08773	2.6	31.6	1120	0.111	0.021	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
14	Q8WXE1	3.2	31.2	791	0.092	0.025	ATRIP_HUMAN ATR-interacting protein OS=Homo sapiens OX=9606 GN=ATRIP PE=1 SV=1
15	Q811U3	4.9	30.8	948	0.078	0.018	RB6I2_RAT ELKS/Rab6-interacting/CAST family member 1 OS=Rattus norvegicus OX=10116 GN=Erc1 PE=1 SV=1
16	Q8AW20	5.3	30.4	667	0.111	0.036	Q8AW20_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=stat4 PE=3 SV=1
17	Q54QH4	6.2	30.4	905	0.203	0.049	Q54QH4_DICDI WASP-related protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283827 PE=4 SV=1
18	B7FX91	7.9	30.0	468	0.069	0.032	BZP14_PHATC bZIP transcription factor 14 OS=Phaeodactylum tricornutum (strain CCAP 1055/1) OX=556484 GN=bZIP14 PE=2 SV=1
19	P28305	7.9	29.6	269	0.069	0.056	PABC_ECOLI Aminodeoxychorismate lyase OS=Escherichia coli (strain K12) OX=83333 GN=pabC PE=1 SV=1
20	Q6ZWR6	7.9	30.0	8799	0.078	0.002	SYNE1_MOUSE Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	8.5e+02	11.4	Afadin- and alpha -actinin-Binding
2	PF17675 APG6_N	2.4e+02	13.6	Apg6 coiled-coil region
3	PF10211 Ax_dynein_light	4.4	18.7	Axonemal dynein light chain
4	PF10473 CENP-F_leu_zip	3.4e+02	12.7	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF07989 Cnn_1N	1.4e+02	14.1	Centrosomin N-terminal motif 1
6	PF01544 CorA	17	16.2	CorA-like Mg2+ transporter protein
7	PF04977 DivIC	35	15.6	Septum formation initiator
8	PF03961 FapA	5.1e+02	11.7	Flagellar Assembly Protein A beta solenoid domain
9	PF04728 LPP	3.7e+02	12.8	Lipoprotein leucine-zipper
10	PF18517 LZ3wCH	1.6e-15	68.2	Leucine zipper with capping helix domain
11	PF03962 Mnd1	99	14.6	Mnd1 HTH domain
12	PF05531 NPV_P10	3.3e+02	13.2	Nucleopolyhedrovirus P10 protein
13	PF03965 Penicillinase_R	0.0061	28.3	Penicillinase repressor
14	PF02403 Seryl_tRNA_N	66	15.2	Seryl-tRNA synthetase N-terminal domain
15	PF17107 SesA	5.5e+02	12.1	N-terminal domain on NACHT_NTPase and P-loop NTPases
16	PF16740 SKA2	4.5e+02	12.1	Spindle and kinetochore-associated protein 2
17	PF04102 SlyX	4.9	19.2	SlyX
18	PF14712 Snapin_Pallidin	0.09	24.6	Snapin/Pallidin
19	PF08286 Spc24	1.5	20.5	Spc24 subunit of Ndc80
20	PF07061 Swi5	7e+02	11.8	Swi5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377384

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240488	0.999	Meiotic nuclear division protein 1 homolog
2	9606.ENSP00000372088	0.978	DNA repair protein RAD51 homolog 1
3	9606.ENSP00000216024	0.966	Meiotic recombination protein DMC1/LIM15 homolog
4	9606.ENSP00000418960	0.949	Breast cancer type 1 susceptibility protein
5	9606.ENSP00000369497	0.926	Breast cancer type 2 susceptibility protein
6	9606.ENSP00000223129	0.919	Replication protein A 14 kDa subunit
7	9606.ENSP00000254719	0.916	Replication protein A 70 kDa DNA-binding subunit
8	9606.ENSP00000434024	0.908	Histone H2AX
9	9606.ENSP00000363017	0.905	Replication protein A 32 kDa subunit
10	9606.ENSP00000257904	0.904	Cyclin-dependent kinase 4
11	9606.ENSP00000278616	0.903	Serine-protein kinase ATM
12	9606.ENSP00000355657	0.902	Histone H3.1t
13	9606.ENSP00000274764	0.900	Histone H2B type 1-A
14	9606.ENSP00000289316	0.900	Histone H2B type 1-D
15	9606.ENSP00000349430	0.900	Histone H2B type 1-K
16	9606.ENSP00000358151	0.900	Histone H2B type 2-E
17	9606.ENSP00000366618	0.900	Histone H2B type 1-L
18	9606.ENSP00000476136	0.900	Histone H2B type 1-J
19	9606.ENSP00000477527	0.900	Histone H2B type 1-O
20	9606.ENSP00000477907	0.900	Histone H2B type 1-M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030374	1.000	nuclear receptor coactivator activity
GO:0044877	0.895	protein-containing complex binding
GO:0140297	0.857	DNA-binding transcription factor binding
GO:0019904	0.855	protein domain specific binding
GO:0050681	0.848	nuclear androgen receptor binding
GO:0046966	0.843	nuclear thyroid hormone receptor binding
GO:0030331	0.839	nuclear estrogen receptor binding
GO:0035259	0.836	nuclear glucocorticoid receptor binding
GO:0050692	0.440	DNA binding domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0016043	0.991	cellular component organization
GO:0006310	0.988	DNA recombination
GO:0022402	0.981	cell cycle process
GO:0006996	0.978	organelle organization
GO:0051276	0.969	chromosome organization
GO:0007059	0.967	chromosome segregation
GO:0000280	0.966	nuclear division
GO:0007127	0.955	meiosis I
GO:0007131	0.954	reciprocal meiotic recombination
GO:0045143	0.925	homologous chromosome segregation
GO:0007129	0.911	homologous chromosome pairing at meiosis
GO:0065007	0.672	biological regulation
GO:0050794	0.592	regulation of cellular process
GO:0060255	0.512	regulation of macromolecule metabolic process
GO:0080090	0.509	regulation of primary metabolic process
GO:0051171	0.509	regulation of nitrogen compound metabolic process
GO:0031323	0.473	regulation of cellular metabolic process
GO:0019219	0.431	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.440	intracellular non-membrane-bounded organelle
GO:0005829	0.357	cytosol
GO:0032991	0.347	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]