StarFunc result for job id Q9P2W7

User Input

>input (334 residues)
MPKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPRRETPPGADPREYCTSD
RDIVEVVRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVV
EDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRET
FPRNSSQPGVVYFADDDNTYSLELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVG
WKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPK
AANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35789	0.953	0.953	3.980E-70	334	0.985	0.985	O35789.pdb.gz	B3GA1_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=B3gat1 PE=1 SV=2
2	AFDB:Q9Z137	0.711	0.732	1.126E-40	324	0.491	0.506	Q9Z137.pdb.gz	B3GA2_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=B3gat2 PE=1 SV=1
3	AFDB:Q5CB07	0.702	0.716	5.081E-37	327	0.458	0.468	Q5CB07.pdb.gz
4	AFDB:F8W289	0.710	0.719	3.414E-35	330	0.431	0.436	F8W289.pdb.gz	F8W289_DANRE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase OS=Danio rerio OX=7955 GN=CHUNP6865 PE=3 SV=1
5	AFDB:O94766	0.716	0.714	3.414E-35	335	0.452	0.451	O94766.pdb.gz	B3GA3_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 PE=1 SV=2
6	AFDB:O97422	0.716	0.779	4.530E-33	306	0.374	0.408	O97422.pdb.gz	B3GI_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase I OS=Drosophila melanogaster OX=7227 GN=GlcAT-I PE=2 SV=2
7	AFDB:Q09363	0.681	0.640	2.725E-32	356	0.341	0.320	Q09363.pdb.gz	SQV8_CAEEL Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase sqv-8 OS=Caenorhabditis elegans OX=6239 GN=sqv-8 PE=1 SV=1
8	AFDB:Q9VTG7	0.633	0.446	2.714E-27	479	0.305	0.213	Q9VTG7.pdb.gz	B3G2P_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase P OS=Drosophila melanogaster OX=7227 GN=GlcAT-P PE=2 SV=1
9	AFDB:Q9VLA1	0.640	0.526	1.258E-25	409	0.323	0.264	Q9VLA1.pdb.gz	B3G2S_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase S OS=Drosophila melanogaster OX=7227 GN=GlcAT-S PE=1 SV=2
10	AFDB:Q9SXC4	0.593	0.507	4.716E-22	394	0.299	0.254	Q9SXC4.pdb.gz	IRX9H_ARATH Probable beta-1,4-xylosyltransferase IRX9H OS=Arabidopsis thaliana OX=3702 GN=IRX9H PE=2 SV=2
11	PDB:6fxrA	0.410	0.218	4.141E-6	700	0.075	0.036	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
12	PDB:4y63A	0.363	0.418	7.227E-6	282	0.117	0.138	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
13	PDB:6pxuB	0.395	0.265	2.069E-5	532	0.147	0.092	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
14	PDB:7msnA	0.331	0.273	2.201E-5	417	0.081	0.065	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
15	PDB:7x8kB	0.384	0.354	2.491E-5	367	0.084	0.076	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
16	PDB:6h0bB	0.393	0.270	2.819E-5	521	0.129	0.083	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
17	PDB:7d72K	0.353	0.332	4.920E-5	360	0.081	0.075	7d72K.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
18	PDB:2d7iA	0.411	0.272	5.924E-5	536	0.123	0.076	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
19	PDB:1h5sB	0.356	0.398	1.034E-4	291	0.102	0.117	1h5sB.pdb.gz	Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.
20	PDB:6b5eB	0.342	0.386	1.100E-4	286	0.096	0.112	6b5eB.pdb.gz	The structure of glucose-1-phosphate thymidylyltransferase from Mycobacterium tuberculosis reveals the location of an essential magnesium ion in the RmlA-type enzymes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35789	0.0	673	334	0.985	0.985	B3GA1_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=B3gat1 PE=1 SV=2
2	Q9CW73	0.0	673	334	0.985	0.985	B3GA1_MOUSE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Mus musculus OX=10090 GN=B3gat1 PE=2 SV=3
3	Q9P2W7	0.0	681	334	1.000	1.000	B3GA1_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GAT1 PE=1 SV=2
4	Q9Z137	1.33e-97	293	324	0.503	0.519	B3GA2_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=B3gat2 PE=1 SV=1
5	Q9NPZ5	1.62e-95	288	323	0.440	0.455	B3GA2_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GAT2 PE=1 SV=2
6	F8W289	1.49e-87	268	330	0.437	0.442	F8W289_DANRE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase OS=Danio rerio OX=7955 GN=CHUNP6865 PE=3 SV=1
7	P58158	1.83e-83	258	335	0.434	0.433	B3GA3_MOUSE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Mus musculus OX=10090 GN=B3gat3 PE=1 SV=1
8	O94766	3.43e-83	257	335	0.440	0.439	B3GA3_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 PE=1 SV=2
9	O97422	9.50e-70	221	306	0.374	0.408	B3GI_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase I OS=Drosophila melanogaster OX=7227 GN=GlcAT-I PE=2 SV=2
10	Q09363	1.21e-68	220	356	0.347	0.326	SQV8_CAEEL Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase sqv-8 OS=Caenorhabditis elegans OX=6239 GN=sqv-8 PE=1 SV=1
11	Q9VTG7	1.61e-50	176	479	0.305	0.213	B3G2P_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase P OS=Drosophila melanogaster OX=7227 GN=GlcAT-P PE=2 SV=1
12	Q9VLA1	9.28e-49	170	409	0.305	0.249	B3G2S_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase S OS=Drosophila melanogaster OX=7227 GN=GlcAT-S PE=1 SV=2
13	Q9SXC4	7.94e-29	116	394	0.263	0.223	IRX9H_ARATH Probable beta-1,4-xylosyltransferase IRX9H OS=Arabidopsis thaliana OX=3702 GN=IRX9H PE=2 SV=2
14	Q7XTB2	8.11e-23	99.8	381	0.257	0.226	GT43H_ORYSJ Probable glucuronosyltransferase Os04g0103100 OS=Oryza sativa subsp. japonica OX=39947 GN=GT43H PE=2 SV=2
15	Q5QM25	9.85e-23	100	446	0.246	0.184	IRX9L_ORYSJ Probable beta-1,4-xylosyltransferase IRX9L OS=Oryza sativa subsp. japonica OX=39947 GN=IRX9L PE=2 SV=1
16	Q6AT32	1.00e-22	100	451	0.234	0.173	GT43E_ORYSJ Probable beta-1,4-xylosyltransferase GT43E OS=Oryza sativa subsp. japonica OX=39947 GN=GT43E PE=2 SV=1
17	Q653F4	2.12e-15	79.0	524	0.254	0.162	IRX14_ORYSJ Probable beta-1,4-xylosyltransferase IRX14 OS=Oryza sativa subsp. japonica OX=39947 GN=IRX14 PE=2 SV=1
18	Q8W4Z4	1.96e-14	75.1	336	0.216	0.214	Q8W4Z4_GOSHI Glycosyltransferases (Fragment) OS=Gossypium hirsutum OX=3635 GN=f14 PE=2 SV=1
19	Q6V9S8	2.15e-14	75.5	368	0.216	0.196	Q6V9S8_GOSHI Glycosyltransferases OS=Gossypium hirsutum OX=3635 GN=GT43A1 PE=2 SV=1
20	Q9FH90	1.68e-13	73.2	492	0.243	0.165	IX14H_ARATH Probable beta-1,4-xylosyltransferase IRX14H OS=Arabidopsis thaliana OX=3702 GN=IRX14H PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03360 Glyco_transf_43	7.9e-71	249.7	Glycosyltransferase family 43

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000433847

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264249	0.966	Carbohydrate sulfotransferase 10
2	9606.ENSP00000292377	0.943	Glypican-2
3	9606.ENSP00000252575	0.932	Neurocan core protein
4	9606.ENSP00000370542	0.931	Syndecan-1
5	9606.ENSP00000310696	0.919	Beta-1,4-galactosyltransferase 2
6	9606.ENSP00000377836	0.919	Glypican-3
7	9606.ENSP00000344468	0.918	Syndecan-3
8	9606.ENSP00000331210	0.917	Brevican core protein
9	9606.ENSP00000366267	0.917	Glypican-5
10	9606.ENSP00000480428	0.917	Beta-1,4-galactosyltransferase 3
11	9606.ENSP00000307046	0.916	Syndecan-2
12	9606.ENSP00000369055	0.914	Beta-1,4-galactosyltransferase 1
13	9606.ENSP00000264039	0.911	Glypican-1
14	9606.ENSP00000361818	0.910	Syndecan-4
15	9606.ENSP00000373244	0.909	Chondroitin sulfate proteoglycan 5
16	9606.ENSP00000359864	0.906	Glypican-4
17	9606.ENSP00000366246	0.906	Glypican-6
18	9606.ENSP00000312506	0.905	Chondroitin sulfate proteoglycan 4
19	9606.ENSP00000368678	0.905	Agrin
20	9606.ENSP00000052754	0.902	Decorin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015020	1.000	glucuronosyltransferase activity
GO:0015018	0.986	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.961	cellular process
GO:0044238	0.925	primary metabolic process
GO:0071704	0.912	organic substance metabolic process
GO:0050896	0.864	response to stimulus
GO:0032501	0.492	multicellular organismal process
GO:0051716	0.488	cellular response to stimulus
GO:0006807	0.414	nitrogen compound metabolic process
GO:0050789	0.387	regulation of biological process
GO:1901564	0.366	organonitrogen compound metabolic process
GO:0043170	0.345	macromolecule metabolic process
GO:0009058	0.313	biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0070013	0.802	intracellular organelle lumen
GO:0071944	0.614	cell periphery
GO:0005886	0.579	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21032	1.000	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	1.000	glucuronosyltransferase.
RHEA:24168	0.986	3-O-(beta-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-xylosyl)-L-seryl-[protein] + UDP-alpha-D-glucuronate = 3-O-(beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl)-L-seryl-[protein] + H(+) + UDP
EC:2.4.1.135	0.986	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase.

[back to server]