StarFunc result for job id Q9P2W9

User Input

>input (335 residues)
MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHI
GKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHK
EIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES
TSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQ
RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNE
DIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2W9	1.000	1.000	5.701E-43	335	1.000	1.000	Q9P2W9.pdb.gz	STX18_HUMAN Syntaxin-18 OS=Homo sapiens OX=9606 GN=STX18 PE=1 SV=1
2	AFDB:Q9VC58	0.358	0.306	6.780E-13	395	0.370	0.314	Q9VC58.pdb.gz	Q9VC58_DROME LD37002p OS=Drosophila melanogaster OX=7227 GN=Syx18 PE=1 SV=1
3	AFDB:Q54TZ2	0.346	0.307	5.003E-11	386	0.287	0.249	Q54TZ2.pdb.gz	Q54TZ2_DICDI SNARE-complex protein Syntaxin-18 N-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281429 PE=3 SV=1
4	AFDB:Q20797	0.316	0.264	1.789E-6	413	0.158	0.128	Q20797.pdb.gz	STX5_CAEEL Putative syntaxin-5 OS=Caenorhabditis elegans OX=6239 GN=syx-5 PE=3 SV=1
5	AFDB:Q24509	0.357	0.267	3.232E-6	467	0.146	0.105	Q24509.pdb.gz	STX5_DROME Syntaxin-5 OS=Drosophila melanogaster OX=7227 GN=Syx5 PE=2 SV=2
6	AFDB:Q08851	0.357	0.340	3.598E-6	355	0.134	0.127	Q08851.pdb.gz	STX5_RAT Syntaxin-5 OS=Rattus norvegicus OX=10116 GN=Stx5 PE=1 SV=2
7	AFDB:Q5AQA4	0.337	0.329	6.501E-6	344	0.152	0.148	Q5AQA4.pdb.gz	Q5AQA4_EMENI ER-Golgi SNARE complex subunit Sed5 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09526 PE=3 SV=1
8	AFDB:Q01590	0.347	0.343	1.308E-5	340	0.143	0.141	Q01590.pdb.gz	SED5_YEAST Integral membrane protein SED5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SED5 PE=1 SV=1
9	AFDB:Q9FFK1	0.349	0.348	1.622E-5	336	0.179	0.179	Q9FFK1.pdb.gz	SYP31_ARATH Syntaxin-31 OS=Arabidopsis thaliana OX=3702 GN=SYP31 PE=1 SV=1
10	AFDB:Q9TY08	0.308	0.312	1.123E-4	329	0.131	0.134	Q9TY08.pdb.gz	Q9TY08_CAEEL t-SNARE coiled-coil homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=syx-16 PE=1 SV=2
11	PDB:3c98B	0.302	0.421	1.069E-1	230	0.066	0.096	3c98B.pdb.gz
12	PDB:7q83D	0.207	0.372	1.256E-1	156	0.048	0.103	7q83D.pdb.gz
13	PDB:3lxuX	0.139	0.053	1.079	1217	0.045	0.012	3lxuX.pdb.gz
14	PDB:7aqsE	0.169	0.323	1.079	159	0.048	0.101	7aqsE.pdb.gz	Identification of a Dps contamination in Mitomycin-C-induced expression of Colicin Ia.
15	PDB:7fikI	0.175	0.088	1.572	729	0.051	0.023	7fikI.pdb.gz
16	PDB:5wlcST	0.153	0.094	1.751	599	0.084	0.047	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
17	PDB:7v61B	0.139	0.074	1.751	751	0.039	0.017	7v61B.pdb.gz
18	PDB:7qpgW	0.267	0.122	1.847	779	0.060	0.026	7qpgW.pdb.gz
19	PDB:5xjt2	0.102	0.143	2.417	217	0.060	0.092	5xjt2.pdb.gz	Structures of 7S mutant complexes
20	PDB:5ynxA	0.207	0.470	2.692	117	0.066	0.188	5ynxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FW4	0.0	617	334	0.928	0.931	STX18_RAT Syntaxin-18 OS=Rattus norvegicus OX=10116 GN=Stx18 PE=2 SV=1
2	Q8VDS8	0.0	613	334	0.925	0.928	STX18_MOUSE Syntaxin-18 OS=Mus musculus OX=10090 GN=Stx18 PE=1 SV=2
3	Q9P2W9	0.0	689	335	1.000	1.000	STX18_HUMAN Syntaxin-18 OS=Homo sapiens OX=9606 GN=STX18 PE=1 SV=1
4	Q9VC58	4.17e-48	168	395	0.382	0.324	Q9VC58_DROME LD37002p OS=Drosophila melanogaster OX=7227 GN=Syx18 PE=1 SV=1
5	Q54TZ2	3.34e-17	84.0	386	0.188	0.163	Q54TZ2_DICDI SNARE-complex protein Syntaxin-18 N-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281429 PE=3 SV=1
6	C0H5E1	2.32e-04	45.1	441	0.078	0.059	C0H5E1_PLAF7 Syntaxin, Qa-SNARE family OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1326800 PE=4 SV=1
7	Q54JY7	0.011	39.7	356	0.087	0.081	STX7A_DICDI Syntaxin-7A OS=Dictyostelium discoideum OX=44689 GN=syn7A PE=1 SV=1
8	A2QYG9	0.025	38.5	308	0.063	0.068	A2QYG9_ASPNC Contig An12c0040, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An12g01190 PE=3 SV=1
9	P41834	0.086	37.0	346	0.224	0.217	UFE1_YEAST Syntaxin UFE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFE1 PE=1 SV=2
10	Q9SRV7	0.13	36.2	306	0.057	0.062	SY131_ARATH Putative syntaxin-131 OS=Arabidopsis thaliana OX=3702 GN=SYP131 PE=3 SV=1
11	A0A1D8PRK4	0.24	35.4	306	0.066	0.072	A0A1D8PRK4_CANAL Ufe1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UFE1 PE=3 SV=1
12	Q8LPJ4	0.71	34.3	605	0.066	0.036	AB2E_ARATH ABC transporter E family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCE2 PE=2 SV=1
13	A0A9K4	0.72	33.9	303	0.060	0.066	A0A9K4_ASPOZ Syntaxin OS=Aspergillus oryzae OX=5062 GN=Aosso1 PE=3 SV=1
14	F1MMT2	1.1	33.9	1964	0.140	0.024	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
15	Q381F4	1.3	32.3	154	0.054	0.117	Q381F4_TRYB2 t-SNARE coiled-coil homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8000 PE=4 SV=1
16	A0A0R4IPF2	1.5	33.5	2349	0.072	0.010	A0A0R4IPF2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
17	A0A2R8Q4T2	1.8	33.1	2267	0.072	0.011	A0A2R8Q4T2_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=crebbpa PE=1 SV=1
18	Q9USH7	4.3	31.2	284	0.060	0.070	PSY1_SCHPO Syntaxin-like protein psy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psy1 PE=3 SV=1
19	P56962	4.7	31.2	302	0.054	0.060	STX17_HUMAN Syntaxin-17 OS=Homo sapiens OX=9606 GN=STX17 PE=1 SV=2
20	A3KNH4	5.8	31.2	730	0.051	0.023	A3KNH4_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=cb479 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19795 DUF6279	6.4	18.2	Family of unknown function (DUF6279)
2	PF20210 Laa1_Sip1_HTR5	2.5e+02	13.0	Laa1/Sip1/HEATR5 HEAT repeat region
3	PF06892 Phage_CP76	42	15.5	Phage regulatory protein CII (CP76)
4	PF10496 Syntaxin-18_N	2.9e-19	80.4	SNARE-complex protein Syntaxin-18 N-terminus
5	PF07739 TipAS	67	15.4	TipAS antibiotic-recognition domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305810

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231668	0.999	BCL2/adenovirus E1B 19kDa interacting protein 1
2	9606.ENSP00000257700	0.999	RAD50-interacting protein 1
3	9606.ENSP00000263897	0.999	Vesicle transport protein USE1
4	9606.ENSP00000200135	0.998	Centromere/kinetochore protein zw10 homolog
5	9606.ENSP00000463393	0.998	Vesicle-trafficking protein SEC22b
6	9606.ENSP00000390783	0.997	Sec1 family domain-containing protein 1
7	9606.ENSP00000281513	0.994	Neuroblastoma-amplified sequence
8	9606.ENSP00000294179	0.991	Syntaxin-5
9	9606.ENSP00000223369	0.963	Synaptobrevin homolog YKT6
10	9606.ENSP00000222547	0.957	BET1 homolog
11	9606.ENSP00000258301	0.952	Syntaxin-6
12	9606.ENSP00000236192	0.951	Vesicle-associated membrane protein 4
13	9606.ENSP00000356918	0.950	Syntaxin-7
14	9606.ENSP00000314157	0.949	Synaptosomal-associated protein 47
15	9606.ENSP00000263354	0.940	Alpha-soluble NSF attachment protein
16	9606.ENSP00000305255	0.939	Syntaxin-8
17	9606.ENSP00000225567	0.933	Golgi SNAP receptor complex member 2
18	9606.ENSP00000263864	0.930	Vesicle-associated membrane protein 8
19	9606.ENSP00000363054	0.930	Syntaxin-12
20	9606.ENSP00000381293	0.929	Vesicle-fusing ATPase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0061024	0.994	membrane organization
GO:0065007	0.988	biological regulation
GO:0032879	0.984	regulation of localization
GO:0051128	0.981	regulation of cellular component organization
GO:0060341	0.972	regulation of cellular localization
GO:0010256	0.971	endomembrane system organization
GO:0006996	0.970	organelle organization
GO:0033043	0.969	regulation of organelle organization
GO:0048522	0.967	positive regulation of cellular process
GO:0044087	0.966	regulation of cellular component biogenesis
GO:0051049	0.959	regulation of transport
GO:1902115	0.956	regulation of organelle assembly
GO:0051130	0.953	positive regulation of cellular component organization
GO:0007029	0.950	endoplasmic reticulum organization
GO:0032386	0.945	regulation of intracellular transport
GO:0010638	0.826	positive regulation of organelle organization
GO:0051050	0.819	positive regulation of transport
GO:0044089	0.819	positive regulation of cellular component biogenesis
GO:0032388	0.788	positive regulation of intracellular transport
GO:0060627	0.765	regulation of vesicle-mediated transport
GO:1902117	0.628	positive regulation of organelle assembly
GO:0051179	0.623	localization
GO:0051234	0.504	establishment of localization
GO:0006810	0.494	transport
GO:0016192	0.346	vesicle-mediated transport
GO:0051641	0.330	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.997	endoplasmic reticulum membrane
GO:0031982	0.867	vesicle
GO:0098588	0.852	bounding membrane of organelle
GO:0031410	0.833	cytoplasmic vesicle
GO:0032991	0.784	protein-containing complex
GO:0098796	0.610	membrane protein complex
GO:0005829	0.443	cytosol
GO:0005886	0.417	plasma membrane
GO:0005794	0.364	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]