StarFunc result for job id Q9P2X3

User Input

>input (320 residues)
MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPN
EYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMT
EPGPDVKKKTEEEDVECEDDLILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPIT
DRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDG
ETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTNSPEE
SSKALGKNKKVRKDKKRNEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2X3	1.000	1.000	9.881E-64	320	1.000	1.000	Q9P2X3.pdb.gz	IMPCT_HUMAN Protein IMPACT OS=Homo sapiens OX=9606 GN=IMPACT PE=1 SV=2
2	AFDB:O55091	0.432	0.434	3.584E-51	318	0.822	0.827	O55091.pdb.gz	IMPCT_MOUSE Protein IMPACT OS=Mus musculus OX=10090 GN=Impact PE=1 SV=2
3	AFDB:O13997	0.420	0.476	2.518E-19	280	0.256	0.293	O13997.pdb.gz	YIH1_SCHPO Protein IMPACT homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yih1 PE=3 SV=1
4	AFDB:P25637	0.395	0.487	1.164E-18	258	0.266	0.329	P25637.pdb.gz	YIH1_YEAST Protein IMPACT homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIH1 PE=1 SV=1
5	PDB:6bqiA	0.317	0.386	3.620E-13	258	0.253	0.314	6bqiA.pdb.gz
6	AFDB:O60090	0.348	0.374	1.997E-9	297	0.141	0.152	O60090.pdb.gz	YO29_SCHPO IMPACT family member C14C8.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC14C8.09c PE=1 SV=3
7	AFDB:A0A0H2USB7	0.328	0.487	1.090E-6	211	0.100	0.152	A0A0H2USB7.pdb.gz	A0A0H2USB7_STRPN Xaa-Pro dipeptidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_2209 PE=1 SV=1
8	AFDB:Q6NW29	0.307	0.493	2.083E-6	188	0.106	0.181	Q6NW29.pdb.gz	RWDD4_HUMAN RWD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RWDD4 PE=1 SV=3
9	AFDB:P27862	0.305	0.464	5.346E-6	204	0.097	0.152	P27862.pdb.gz	YIGZ_ECOLI IMPACT family member YigZ OS=Escherichia coli (strain K12) OX=83333 GN=yigZ PE=1 SV=2
10	AFDB:Q9HGN1	0.312	0.068	7.612E-6	1576	0.156	0.032	Q9HGN1.pdb.gz	GCN2_SCHPO eIF-2-alpha kinase GCN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn2 PE=2 SV=2
11	PDB:1vi7A	0.328	0.498	8.426E-6	206	0.100	0.155	1vi7A.pdb.gz
12	AFDB:Q9CQK7	0.321	0.417	2.197E-5	243	0.075	0.099	Q9CQK7.pdb.gz	RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rwdd1 PE=1 SV=1
13	PDB:3e46A	0.156	0.235	4.574E-2	202	0.041	0.064	3e46A.pdb.gz
14	PDB:4ccgA	0.180	0.340	7.771E-2	157	0.050	0.102	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
15	PDB:7bbdA	0.264	0.493	8.743E-2	149	0.059	0.128	7bbdA.pdb.gz	RING domains act as both substrate and enzyme in a catalytic arrangement to drive self-anchored ubiquitination.
16	PDB:1eqrA	0.180	0.113	9.273E-2	590	0.034	0.019	1eqrA.pdb.gz
17	PDB:6op8A	0.177	0.316	9.836E-2	167	0.031	0.060	6op8A.pdb.gz
18	PDB:3bzhA	0.196	0.364	1.107E-1	161	0.034	0.068	3bzhA.pdb.gz
19	PDB:6zhtB	0.168	0.322	1.245E-1	153	0.072	0.150	6zhtB.pdb.gz
20	PDB:7bbdC	0.173	0.326	1.320E-1	153	0.078	0.163	7bbdC.pdb.gz	RING domains act as both substrate and enzyme in a catalytic arrangement to drive self-anchored ubiquitination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55091	0.0	520	318	0.791	0.796	IMPCT_MOUSE Protein IMPACT OS=Mus musculus OX=10090 GN=Impact PE=1 SV=2
2	Q9P2X3	0.0	662	320	1.000	1.000	IMPCT_HUMAN Protein IMPACT OS=Homo sapiens OX=9606 GN=IMPACT PE=1 SV=2
3	O13997	2.89e-33	125	280	0.278	0.318	YIH1_SCHPO Protein IMPACT homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yih1 PE=3 SV=1
4	P25637	2.44e-31	120	258	0.178	0.221	YIH1_YEAST Protein IMPACT homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIH1 PE=1 SV=1
5	O60090	3.66e-14	73.9	297	0.128	0.138	YO29_SCHPO IMPACT family member C14C8.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC14C8.09c PE=1 SV=3
6	F1RB95	2.86e-05	47.8	459	0.056	0.039	RNF14_DANRE E3 ubiquitin-protein ligase RNF14 OS=Danio rerio OX=7955 GN=rnf14 PE=2 SV=1
7	A0A0H2USB7	9.19e-05	45.1	211	0.097	0.147	A0A0H2USB7_STRPN Xaa-Pro dipeptidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_2209 PE=1 SV=1
8	Q9US46	0.005	40.8	435	0.103	0.076	ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=itt1 PE=3 SV=1
9	Q20871	0.063	37.4	437	0.050	0.037	Q20871_CAEEL RBR-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=CELE_F56D2.5 PE=1 SV=2
10	Q9H446	0.13	35.8	243	0.087	0.115	RWDD1_HUMAN RWD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RWDD1 PE=1 SV=1
11	Q5AGV1	0.21	35.4	259	0.072	0.089	Q5AGV1_CANAL Gir2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIR2 PE=4 SV=1
12	Q9QZ05	0.26	35.8	1648	0.116	0.022	E2AK4_MOUSE eIF-2-alpha kinase GCN2 OS=Mus musculus OX=10090 GN=Eif2ak4 PE=1 SV=2
13	Q4WU06	0.28	35.4	1592	0.103	0.021	Q4WU06_ASPFU non-specific serine/threonine protein kinase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G06750 PE=4 SV=1
14	Q9CQK7	0.32	34.7	243	0.084	0.111	RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rwdd1 PE=1 SV=1
15	Q9P2K8	0.54	34.7	1649	0.113	0.022	E2AK4_HUMAN eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4 PE=1 SV=3
16	Q9QZR0	0.99	33.5	456	0.081	0.057	RNF25_MOUSE E3 ubiquitin-protein ligase RNF25 OS=Mus musculus OX=10090 GN=Rnf25 PE=1 SV=2
17	D4A7V9	1.2	33.5	1649	0.116	0.022	E2AK4_RAT eIF-2-alpha kinase GCN2 OS=Rattus norvegicus OX=10116 GN=Eif2ak4 PE=3 SV=2
18	Q9FIA0	2.1	32.3	450	0.041	0.029	U76C2_ARATH UDP-glycosyltransferase 76C2 OS=Arabidopsis thaliana OX=3702 GN=UGT76C2 PE=1 SV=1
19	Q389P9	3.7	32.0	618	0.044	0.023	Q389P9_TRYB2 Adenosine deaminase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0070 PE=4 SV=1
20	C6KTF7	4.1	32.0	3954	0.041	0.003	C6KTF7_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0632500 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	1.2e-14	65.9	RWD domain
2	PF01205 UPF0029	1.8e-32	123.2	Uncharacterized protein family UPF0029

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284202

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300648	0.901	eIF-2-alpha kinase activator GCN1
2	9606.ENSP00000263791	0.841	eIF-2-alpha kinase GCN2
3	9606.ENSP00000327801	0.734	Protein disulfide-isomerase
4	9606.ENSP00000325448	0.676	Lysine--tRNA ligase
5	9606.ENSP00000355086	0.616	Aspartate--tRNA ligase, mitochondrial
6	9606.ENSP00000420357	0.591	RWD domain-containing protein 1
7	9606.ENSP00000355299	0.516	tRNA-splicing endonuclease subunit Sen15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.691	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0034248	0.992	regulation of amide metabolic process
GO:2000112	0.992	regulation of cellular macromolecule biosynthetic process
GO:0050896	0.991	response to stimulus
GO:0009987	0.991	cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0033554	0.957	cellular response to stress
GO:0007154	0.951	cell communication
GO:0051246	0.938	regulation of protein metabolic process
GO:0010468	0.919	regulation of gene expression
GO:0048519	0.898	negative regulation of biological process
GO:0048522	0.871	positive regulation of cellular process
GO:0048523	0.855	negative regulation of cellular process
GO:0008152	0.822	metabolic process
GO:0071704	0.806	organic substance metabolic process
GO:0044238	0.788	primary metabolic process
GO:0006807	0.766	nitrogen compound metabolic process
GO:0043170	0.681	macromolecule metabolic process
GO:0019219	0.670	regulation of nucleobase-containing compound metabolic process
GO:0010608	0.649	post-transcriptional regulation of gene expression
GO:0006417	0.633	regulation of translation
GO:0071840	0.612	cellular component organization or biogenesis
GO:0044237	0.609	cellular metabolic process
GO:0016043	0.595	cellular component organization
GO:0042594	0.545	response to starvation
GO:0009893	0.526	positive regulation of metabolic process
GO:0009892	0.486	negative regulation of metabolic process
GO:1901564	0.474	organonitrogen compound metabolic process
GO:0009628	0.471	response to abiotic stimulus
GO:0051173	0.471	positive regulation of nitrogen compound metabolic process
GO:0031325	0.471	positive regulation of cellular metabolic process
GO:0006355	0.458	regulation of DNA-templated transcription
GO:0010604	0.452	positive regulation of macromolecule metabolic process
GO:0010557	0.437	positive regulation of macromolecule biosynthetic process
GO:1990928	0.435	response to amino acid starvation
GO:0031328	0.433	positive regulation of cellular biosynthetic process
GO:0034198	0.426	cellular response to amino acid starvation
GO:0070887	0.424	cellular response to chemical stimulus
GO:0032502	0.414	developmental process
GO:0051248	0.414	negative regulation of protein metabolic process
GO:0010033	0.409	response to organic substance
GO:0032501	0.408	multicellular organismal process
GO:0031399	0.406	regulation of protein modification process
GO:0048856	0.403	anatomical structure development
GO:0044087	0.390	regulation of cellular component biogenesis
GO:0001932	0.386	regulation of protein phosphorylation
GO:0071310	0.381	cellular response to organic substance
GO:0140467	0.378	integrated stress response signaling
GO:0051129	0.365	negative regulation of cellular component organization
GO:0043254	0.361	regulation of protein-containing complex assembly
GO:0031400	0.361	negative regulation of protein modification process
GO:0051247	0.356	positive regulation of protein metabolic process
GO:0019538	0.354	protein metabolic process
GO:0031333	0.352	negative regulation of protein-containing complex assembly
GO:0009416	0.350	response to light stimulus
GO:0001933	0.350	negative regulation of protein phosphorylation
GO:1901701	0.348	cellular response to oxygen-containing compound
GO:0010558	0.346	negative regulation of macromolecule biosynthetic process
GO:0010035	0.343	response to inorganic substance
GO:0034599	0.341	cellular response to oxidative stress
GO:0014070	0.339	response to organic cyclic compound
GO:0031327	0.338	negative regulation of cellular biosynthetic process
GO:0006357	0.331	regulation of transcription by RNA polymerase II
GO:0050793	0.317	regulation of developmental process
GO:0006446	0.312	regulation of translational initiation
GO:0007275	0.310	multicellular organism development
GO:0071495	0.309	cellular response to endogenous stimulus
GO:0071407	0.308	cellular response to organic cyclic compound
GO:0071214	0.306	cellular response to abiotic stimulus
GO:0009411	0.304	response to UV
GO:0071482	0.301	cellular response to light stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.998	protein-containing complex
GO:1990904	0.988	ribonucleoprotein complex
GO:0005844	0.984	polysome
GO:0070013	0.982	intracellular organelle lumen
GO:0043231	0.933	intracellular membrane-bounded organelle
GO:0005634	0.883	nucleus
GO:0031981	0.775	nuclear lumen
GO:0005654	0.578	nucleoplasm
GO:0016020	0.525	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]