StarFunc result for job id Q9P2Z0

User Input

>input (257 residues)
MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAP
ACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAARH
SEAAPGPVSCTRPRAGKQAAASQITCENELVQTQPHADNPSNTVTSVPTHCEEGPVHKST
QISLKRPRHRSVGIQAKVKAFGKRLCNATTQTEELWSRTSSLFDIYSSDSETDTDWDIKS
EQSDLSYMAVQVKEETC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2Z0	1.000	1.000	1.142E-42	257	1.000	1.000	Q9P2Z0.pdb.gz	THA10_HUMAN THAP domain-containing protein 10 OS=Homo sapiens OX=9606 GN=THAP10 PE=1 SV=1
2	AFDB:Q27395	0.233	0.053	3.124E-2	1440	0.183	0.033	Q27395.pdb.gz	LI15B_CAEEL Protein lin-15B OS=Caenorhabditis elegans OX=6239 GN=lin-15B PE=2 SV=1
3	PDB:7l08AD	0.066	0.055	4.658	343	0.074	0.055	7l08AD.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
4	AFDB:Q05AN6	0.099	0.091	5.634	284	0.152	0.137	Q05AN6.pdb.gz
5	PDB:1rwuA	0.099	0.239	7.425	87	0.027	0.080	1rwuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P2Z0	0.0	535	257	1.000	1.000	THA10_HUMAN THAP domain-containing protein 10 OS=Homo sapiens OX=9606 GN=THAP10 PE=1 SV=1
2	Q9H0W7	4.29e-06	48.9	228	0.128	0.145	THAP2_HUMAN THAP domain-containing protein 2 OS=Homo sapiens OX=9606 GN=THAP2 PE=1 SV=1
3	Q8WTV1	0.002	40.8	239	0.128	0.138	THAP3_HUMAN THAP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THAP3 PE=1 SV=1
4	Q7Z6K1	0.010	39.3	395	0.113	0.073	THAP5_HUMAN THAP domain-containing protein 5 OS=Homo sapiens OX=9606 GN=THAP5 PE=1 SV=2
5	Q9BT49	0.012	38.9	309	0.125	0.104	THAP7_HUMAN THAP domain-containing protein 7 OS=Homo sapiens OX=9606 GN=THAP7 PE=1 SV=2
6	Q8NA92	0.25	34.7	274	0.089	0.084	THAP8_HUMAN THAP domain-containing protein 8 OS=Homo sapiens OX=9606 GN=THAP8 PE=1 SV=1
7	P34427	2.3	32.0	962	0.070	0.019	LIN36_CAEEL Protein lin-36 OS=Caenorhabditis elegans OX=6239 GN=lin-36 PE=1 SV=2
8	Q9NVV9	3.7	30.8	213	0.113	0.136	THAP1_HUMAN THAP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THAP1 PE=1 SV=1
9	Q57V47	5.1	30.8	591	0.082	0.036	Q57V47_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.480 PE=3 SV=1
10	P9WPI1	5.4	30.8	610	0.125	0.052	ECCA5_MYCTU ESX-5 secretion system protein EccA5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=eccA5 PE=1 SV=1
11	O43422	8.2	30.4	761	0.089	0.030	P52K_HUMAN 52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2
12	Q9CUX1	8.8	30.0	758	0.089	0.030	P52K_MOUSE 52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2
13	A0A1D8PN92	9.9	30.0	1948	0.093	0.012	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05485 THAP	4.9e-09	48.2	THAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292894	0.689	THAP domain containing 8
2	9606.ENSP00000385006	0.681	THAP domain containing 4
3	9606.ENSP00000309007	0.668	THAP domain containing 6
4	9606.ENSP00000453273	0.666	Leucine-rich repeat-containing protein 49
5	9606.ENSP00000400500	0.651	THAP domain-containing protein 5
6	9606.ENSP00000260045	0.618	52 kDa repressor of the inhibitor of the protein kinase
7	9606.ENSP00000305533	0.613	DNA transposase THAP9
8	9606.ENSP00000054650	0.602	THAP domain-containing protein 3
9	9606.ENSP00000215742	0.601	THAP domain-containing protein 7
10	9606.ENSP00000310796	0.559	THAP domain containing 2
11	9606.ENSP00000477310	0.556	Dynein light chain 2, cytoplasmic
12	9606.ENSP00000304689	0.529	THAP domain-containing protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.997	regulation of primary metabolic process
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0006357	0.977	regulation of transcription by RNA polymerase II
GO:0048519	0.881	negative regulation of biological process
GO:0048523	0.867	negative regulation of cellular process
GO:0051172	0.859	negative regulation of nitrogen compound metabolic process
GO:0009987	0.815	cellular process
GO:0045934	0.718	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.707	negative regulation of macromolecule metabolic process
GO:0071704	0.582	organic substance metabolic process
GO:0045892	0.525	negative regulation of DNA-templated transcription
GO:0000122	0.520	negative regulation of transcription by RNA polymerase II
GO:0044238	0.505	primary metabolic process
GO:0044237	0.487	cellular metabolic process
GO:0006807	0.454	nitrogen compound metabolic process
GO:1901360	0.389	organic cyclic compound metabolic process
GO:0006725	0.354	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005654	0.996	nucleoplasm
GO:0005694	0.947	chromosome
GO:0005730	0.468	nucleolus
GO:0005829	0.437	cytosol
GO:0016020	0.396	membrane
GO:0000785	0.375	chromatin
GO:0015630	0.303	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]