StarFunc result for job id Q9UBC1

User Input

>input (381 residues)
MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLD
VDAGQPPPLHRACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPL
LSRCPSAMGIKNKDGETPGQILGWGPPWDSAEEEEEDDASKEREWRQKLQGELEDEWQEV
MGRFEGDASHETQEPESFSAWSDRLAREHAQKCQQQQREAEGSCRPPRAEGSSQSWRQQE
EEQRLFRERARAKEEELRESRARRAQEALGDREPKPTRAGPREEHPRGAGRGSLWRFGDV
PWPCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQVRWHPDRFLQRFRSQIETWELG
RVMGAVTALSQALNRHAEALK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88995	0.389	0.389	1.522E-50	381	0.924	0.924	O88995.pdb.gz	IKBL1_MOUSE NF-kappa-B inhibitor-like protein 1 OS=Mus musculus OX=10090 GN=Nfkbil1 PE=2 SV=1
2	AFDB:Q6NXT1	0.278	0.343	1.187E-4	300	0.142	0.180	Q6NXT1.pdb.gz	ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens OX=9606 GN=ANKRD54 PE=1 SV=2
3	AFDB:Q05921	0.275	0.147	1.695E-4	735	0.094	0.049	Q05921.pdb.gz	RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus OX=10090 GN=Rnasel PE=1 SV=2
4	AFDB:Q9STP8	0.286	0.306	3.124E-4	354	0.076	0.082	Q9STP8.pdb.gz	ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=ACBP2 PE=1 SV=1
5	AFDB:Q05823	0.270	0.142	3.287E-4	741	0.081	0.042	Q05823.pdb.gz	RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens OX=9606 GN=RNASEL PE=1 SV=2
6	AFDB:Q9H765	0.250	0.324	5.200E-4	288	0.097	0.128	Q9H765.pdb.gz	ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens OX=9606 GN=ASB8 PE=1 SV=1
7	AFDB:Q3V096	0.192	0.141	5.472E-4	527	0.131	0.095	Q3V096.pdb.gz	ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus OX=10090 GN=Ankrd42 PE=1 SV=1
8	AFDB:Q8WWH4	0.133	0.110	6.709E-4	475	0.168	0.135	Q8WWH4.pdb.gz	ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASZ1 PE=1 SV=1
9	AFDB:Q587C7	0.244	0.226	7.059E-4	413	0.110	0.102	Q587C7.pdb.gz	Q587C7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.420 PE=4 SV=1
10	AFDB:Q00653	0.219	0.101	8.225E-4	900	0.126	0.053	Q00653.pdb.gz	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
11	PDB:7df7B	0.251	0.727	1.164E-3	119	0.084	0.269	7df7B.pdb.gz
12	PDB:2dvwA	0.249	0.405	1.662E-3	229	0.084	0.140	2dvwA.pdb.gz
13	PDB:6jd6B	0.197	0.350	1.749E-3	192	0.100	0.198	6jd6B.pdb.gz
14	PDB:8cs9A	0.246	0.120	2.375E-3	796	0.084	0.040	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
15	PDB:4oauC	0.242	0.136	2.499E-3	692	0.071	0.039	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
16	PDB:6pqpA	0.247	0.156	7.666E-3	615	0.084	0.052	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
17	PDB:6v9xA	0.248	0.168	8.488E-3	571	0.081	0.054	6v9xA.pdb.gz
18	PDB:4bszB	0.252	0.596	8.932E-3	150	0.063	0.160	4bszB.pdb.gz
19	PDB:3ehqA	0.241	0.486	1.276E-2	182	0.066	0.137	3ehqA.pdb.gz
20	PDB:1bd8A	0.200	0.429	1.646E-2	156	0.058	0.141	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRT5	0.0	712	366	0.958	0.997	A0A0A0MRT5_HUMAN NF-kappa-B inhibitor-like protein 1 OS=Homo sapiens OX=9606 GN=NFKBIL1 PE=1 SV=1
2	O88995	0.0	656	381	0.924	0.924	IKBL1_MOUSE NF-kappa-B inhibitor-like protein 1 OS=Mus musculus OX=10090 GN=Nfkbil1 PE=2 SV=1
3	Q5STV6	0.0	706	358	0.937	0.997	Q5STV6_HUMAN NF-kappa-B inhibitor-like protein 1 OS=Homo sapiens OX=9606 GN=NFKBIL1 PE=1 SV=2
4	Q9UBC1	0.0	753	381	0.997	0.997	IKBL1_HUMAN NF-kappa-B inhibitor-like protein 1 OS=Homo sapiens OX=9606 GN=NFKBIL1 PE=1 SV=2
5	Q00653	2.50e-05	48.9	900	0.060	0.026	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
6	Q551Q8	4.69e-05	47.8	843	0.079	0.036	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
7	Q9VUX2	1.58e-04	46.2	1226	0.102	0.032	MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3
8	Q8IDX6	1.84e-04	46.2	3130	0.113	0.014	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
9	O60237	4.73e-04	44.7	982	0.079	0.031	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
10	Q9WTK5	4.73e-04	44.7	899	0.055	0.023	NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus OX=10090 GN=Nfkb2 PE=1 SV=1
11	Q8BG95	5.03e-04	44.7	976	0.079	0.031	MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus OX=10090 GN=Ppp1r12b PE=1 SV=2
12	O74205	5.06e-04	44.3	441	0.079	0.068	TOXE_COCCA Transcription factor TOXE OS=Cochliobolus carbonum OX=5017 GN=TOXE PE=1 SV=1
13	Q812A3	5.85e-04	43.9	306	0.089	0.111	ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus OX=10090 GN=Ankrd23 PE=2 SV=1
14	A0A0S2Z4Q8	7.42e-04	42.4	184	0.079	0.163	A0A0S2Z4Q8_HUMAN Protein phosphatase 1 regulatory subunit 12B isoform 2 OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=1
15	A0A8I6G6F3	0.001	43.5	902	0.052	0.022	A0A8I6G6F3_RAT Nuclear factor kappa B subunit 2 OS=Rattus norvegicus OX=10116 GN=Nfkb2 PE=1 SV=1
16	A8JNM5	0.001	43.9	4264	0.073	0.007	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	M9MRS5	0.001	43.9	4496	0.073	0.006	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	M9PEN3	0.001	43.9	4373	0.073	0.006	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	Q8C8R3	0.001	43.9	3898	0.097	0.009	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2
20	Q9BQI6	0.001	43.5	1058	0.071	0.026	SLF1_HUMAN SMC5-SMC6 complex localization factor protein 1 OS=Homo sapiens OX=9606 GN=SLF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	4.2	19.1	Ankyrin repeat
2	PF12796 Ank_2	0.28	23.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.046	25.1	Ankyrin repeat
4	PF13637 Ank_4	0.041	25.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2	20.1	Ankyrin repeats (many copies)
6	PF16660 PHD20L1_u1	2.2e+02	14.0	PHD finger protein 20-like protein 1
7	PF10602 RPN7	5.1e+02	11.8	26S proteasome subunit RPN7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000005876

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000005414	0.658	Proline-rich coiled-coil 2A
2	9593.ENSGGOP00000005420	0.657	Chromosome 6 open reading frame 47
3	9593.ENSGGOP00000011094	0.656	valyl-tRNA synthetase
4	9593.ENSGGOP00000026653	0.603	TSC22 domain family, member 2
5	9593.ENSGGOP00000005868	0.602	V-type proton ATPase subunit G
6	9593.ENSGGOP00000003805	0.595	Capping protein regulator and myosin 1 linker 2
7	9593.ENSGGOP00000028319	0.531	Zinc finger Ran-binding domain-containing protein 2
8	9593.ENSGGOP00000011138	0.526	Ubiquitination factor E4A
9	9593.ENSGGOP00000016894	0.526	Mortality factor 4 like 1
10	9593.ENSGGOP00000024841	0.525	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048583	0.991	regulation of response to stimulus
GO:0051716	0.989	cellular response to stimulus
GO:0048519	0.977	negative regulation of biological process
GO:0080134	0.963	regulation of response to stress
GO:0060255	0.935	regulation of macromolecule metabolic process
GO:0048523	0.932	negative regulation of cellular process
GO:0042221	0.929	response to chemical
GO:0009605	0.929	response to external stimulus
GO:0031323	0.921	regulation of cellular metabolic process
GO:0051171	0.920	regulation of nitrogen compound metabolic process
GO:0080090	0.919	regulation of primary metabolic process
GO:0009607	0.912	response to biotic stimulus
GO:0023051	0.906	regulation of signaling
GO:0010646	0.906	regulation of cell communication
GO:0048585	0.906	negative regulation of response to stimulus
GO:0010468	0.903	regulation of gene expression
GO:0010556	0.876	regulation of macromolecule biosynthetic process
GO:0031326	0.876	regulation of cellular biosynthetic process
GO:0019219	0.876	regulation of nucleobase-containing compound metabolic process
GO:0009966	0.870	regulation of signal transduction
GO:0002831	0.844	regulation of response to biotic stimulus
GO:0044419	0.838	biological process involved in interspecies interaction between organisms
GO:0043207	0.828	response to external biotic stimulus
GO:0051707	0.802	response to other organism
GO:0032101	0.796	regulation of response to external stimulus
GO:0006355	0.788	regulation of DNA-templated transcription
GO:0010033	0.770	response to organic substance
GO:0051239	0.762	regulation of multicellular organismal process
GO:0023052	0.760	signaling
GO:0010605	0.758	negative regulation of macromolecule metabolic process
GO:0065009	0.750	regulation of molecular function
GO:0002682	0.750	regulation of immune system process
GO:0007165	0.746	signal transduction
GO:0051090	0.733	regulation of DNA-binding transcription factor activity
GO:0001817	0.700	regulation of cytokine production
GO:0071216	0.673	cellular response to biotic stimulus
GO:0002237	0.661	response to molecule of bacterial origin
GO:1903555	0.636	regulation of tumor necrosis factor superfamily cytokine production
GO:0050776	0.617	regulation of immune response
GO:0031347	0.582	regulation of defense response
GO:0009968	0.577	negative regulation of signal transduction
GO:0032088	0.575	negative regulation of NF-kappaB transcription factor activity
GO:0002832	0.538	negative regulation of response to biotic stimulus
GO:0045088	0.527	regulation of innate immune response
GO:0032496	0.489	response to lipopolysaccharide
GO:0001818	0.455	negative regulation of cytokine production
GO:0071219	0.453	cellular response to molecule of bacterial origin
GO:0062207	0.444	regulation of pattern recognition receptor signaling pathway
GO:0071704	0.438	organic substance metabolic process
GO:0035556	0.437	intracellular signal transduction
GO:0048518	0.422	positive regulation of biological process
GO:0070887	0.403	cellular response to chemical stimulus
GO:1903556	0.391	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0044238	0.371	primary metabolic process
GO:0071310	0.331	cellular response to organic substance
GO:0006807	0.330	nitrogen compound metabolic process
GO:0032102	0.311	negative regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.802	cytoplasm
GO:0005829	0.542	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]