StarFunc result for job id Q9UBC2

User Input

>input (864 residues)
MAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGFLDKQGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAH
WAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLD
RDEFAVAMHLVYRALEKEPVPSALPPSLIPPSKRKKTVFPGAVPVLPASPPPKDSLRSTP
SHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVK
EIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVP
PSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSE
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSL
KTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEI
NQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAMDDP
FKNKALLFSNNTQELHPDPFQTEDPFKSDPFKGADPFKGDPFQNDPFAEQQTTSTDPFGG
DPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSVSSKG
SDPFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPFKSKQDTPALP
PKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDP
FVPSSAAKPSKASASGFADFTSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60902	0.579	0.556	7.278E-104	907	0.920	0.877	Q60902.pdb.gz	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
2	AFDB:A7BFV9	0.221	0.215	2.173E-54	897	0.465	0.448	A7BFV9.pdb.gz	A7BFV9_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
3	AFDB:P42566	0.190	0.184	1.671E-53	896	0.473	0.456	P42566.pdb.gz	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
4	AFDB:Q8WQ61	0.240	0.176	5.723E-44	1253	0.341	0.235	Q8WQ61.pdb.gz	Q8WQ61_DROME Eps-15 protein OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=2 SV=1
5	AFDB:Q8MMD2	0.167	0.129	1.874E-42	1232	0.346	0.243	Q8MMD2.pdb.gz	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
6	AFDB:Q8MMD3	0.171	0.141	4.669E-42	1106	0.347	0.271	Q8MMD3.pdb.gz	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
7	PDB:4cidA	0.114	0.196	2.094E-8	497	0.058	0.101	4cidA.pdb.gz	Structural Insights Into Membrane Interaction and Caveolar Targeting of Dynamin-Like Ehd2.
8	AFDB:Q10172	0.117	0.062	5.069E-8	1794	0.172	0.083	Q10172.pdb.gz	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
9	AFDB:Q80VJ8	0.191	0.248	1.210E-5	648	0.108	0.144	Q80VJ8.pdb.gz	KASH5_MOUSE Protein KASH5 OS=Mus musculus OX=10090 GN=Kash5 PE=1 SV=3
10	AFDB:Q9BSW2	0.169	0.196	2.431E-5	731	0.105	0.124	Q9BSW2.pdb.gz	EFC4B_HUMAN EF-hand calcium-binding domain-containing protein 4B OS=Homo sapiens OX=9606 GN=CRACR2A PE=1 SV=2
11	PDB:7soxA	0.105	0.174	2.384E-4	514	0.053	0.089	7soxA.pdb.gz
12	AFDB:Q8N6L0	0.185	0.272	3.963E-4	562	0.108	0.165	Q8N6L0.pdb.gz	KASH5_HUMAN Protein KASH5 OS=Homo sapiens OX=9606 GN=KASH5 PE=1 SV=2
13	PDB:2zfdA	0.071	0.287	1.402E-3	183	0.049	0.230	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
14	PDB:1v1fA	0.075	0.294	2.153E-3	188	0.037	0.170	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
15	PDB:5a2hA	0.076	0.325	2.397E-3	147	0.037	0.218	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
16	PDB:7eebI	0.071	0.325	2.529E-3	174	0.031	0.155	7eebI.pdb.gz	Structure of a mammalian sperm cation channel complex.
17	PDB:2f2pA	0.081	0.338	2.669E-3	169	0.034	0.172	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
18	PDB:1ggzA	0.071	0.364	2.971E-3	144	0.036	0.215	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
19	PDB:1a2xA	0.075	0.336	3.308E-3	158	0.031	0.171	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
20	PDB:2n6aA	0.069	0.303	4.101E-3	162	0.038	0.204	2n6aA.pdb.gz	An investigation of calcium mediate signaling by the Connexin 36 gap junction protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC99	0.0	660	897	0.470	0.453	A0A8I5YC99_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
2	A0A8I6ALY1	0.0	607	847	0.446	0.455	A0A8I6ALY1_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
3	A7BFV9	0.0	661	897	0.471	0.454	A7BFV9_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
4	E9PSY8	0.0	638	873	0.462	0.457	E9PSY8_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=3
5	P42566	0.0	687	896	0.485	0.468	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
6	P42567	0.0	640	897	0.468	0.450	EPS15_MOUSE Epidermal growth factor receptor substrate 15 OS=Mus musculus OX=10090 GN=Eps15 PE=1 SV=1
7	Q5JC29	0.0	641	792	0.438	0.477	Q5JC29_RAT Epidermal growth factor receptor pathway substrate 15 isoform B OS=Rattus norvegicus OX=10116 GN=Eps15 PE=2 SV=1
8	Q60902	0.0	1481	907	0.920	0.877	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
9	Q9UBC2	0.0	1732	864	1.000	1.000	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
10	B1AUU8	5.42e-174	523	762	0.309	0.350	B1AUU8_HUMAN Epidermal growth factor receptor pathway substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=1
11	A0A8I6GAG1	2.75e-166	504	764	0.299	0.338	A0A8I6GAG1_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
12	E3CTP7	3.12e-127	403	792	0.334	0.365	E3CTP7_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform D OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
13	Q8MMD3	5.87e-124	402	1106	0.332	0.259	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
14	Q9W111	5.06e-63	233	1253	0.194	0.134	Q9W111_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform A OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=2
15	Q8WQ61	5.24e-63	233	1253	0.194	0.134	Q8WQ61_DROME Eps-15 protein OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=2 SV=1
16	Q8MMD2	3.41e-60	225	1232	0.196	0.137	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
17	Q9BIF4	7.72e-54	202	796	0.204	0.221	Q9BIF4_CAEEL EHS-1 OS=Caenorhabditis elegans OX=6239 GN=ehs-1 PE=1 SV=1
18	Q9HGL2	1.07e-37	155	1116	0.127	0.099	YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC800.10c PE=4 SV=1
19	Q6GMY7	1.30e-34	143	648	0.108	0.144	Q6GMY7_HUMAN ITSN1 protein (Fragment) OS=Homo sapiens OX=9606 GN=ITSN1 PE=2 SV=1
20	A0A1D8PF53	1.50e-34	145	1296	0.125	0.083	A0A1D8PF53_CANAL Cta3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTA3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	8.4	18.1	Autophagy protein 16 (ATG16)
2	PF07888 CALCOCO1	3.5	18.1	Calcium binding and coiled-coil domain (CALCOCO1) like
3	PF19220 Crescentin	0.81	20.3	Crescentin protein
4	PF01519 DUF16	3.5e+02	13.1	Protein of unknown function DUF16
5	PF15960 DUF4763	7.2e+02	10.8	Domain of unknown function (DUF4763)
6	PF05335 DUF745	14	16.8	Protein of unknown function (DUF745)
7	PF00036 EF-hand_1	3.5e-11	52.9	EF hand
8	PF12763 EF-hand_4	5.4e-37	137.3	Cytoskeletal-regulatory complex EF hand
9	PF13202 EF-hand_5	21	16.0	EF hand
10	PF13405 EF-hand_6	1e-05	35.9	EF-hand domain
11	PF13499 EF-hand_7	0.003	29.3	EF-hand domain pair
12	PF13833 EF-hand_8	2.8	19.1	EF-hand domain pair
13	PF14658 EF-hand_9	8.8	18.1	EF-hand domain
14	PF06160 EzrA	13	15.5	Septation ring formation regulator, EzrA
15	PF06818 Fez1	1.8e+02	14.0	Fez1
16	PF10498 IFT57	13	16.2	Intra-flagellar transport protein 57
17	PF04791 LMBR1	27	15.1	LMBR1-like membrane protein
18	PF17060 MPS2	3.6e+02	12.0	Monopolar spindle protein 2
19	PF12795 MscS_porin	96	14.0	Mechanosensitive ion channel porin domain
20	PF00261 Tropomyosin	40	15.0	Tropomyosin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393313

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406209	0.981	Epsin-1
2	9606.ENSP00000320543	0.957	Epsin-2
3	9606.ENSP00000450857	0.951	Stonin-2
4	9606.ENSP00000347244	0.940	Intersectin-2
5	9606.ENSP00000328551	0.935	Ras-related protein Rab-28
6	9606.ENSP00000268933	0.924	Epsin-3
7	9606.ENSP00000292807	0.916	AP-2 complex subunit mu
8	9606.ENSP00000360798	0.914	Epidermal growth factor receptor substrate 15
9	9606.ENSP00000363667	0.912	Tyrosine-protein phosphatase non-receptor type 3
10	9606.ENSP00000263270	0.907	AP-2 complex subunit sigma
11	9606.ENSP00000370719	0.905	Intersectin-1
12	9606.ENSP00000376345	0.905	Growth factor receptor-bound protein 2
13	9606.ENSP00000351926	0.902	AP-2 complex subunit alpha-1
14	9606.ENSP00000327694	0.901	AP-2 complex subunit alpha-2
15	9606.ENSP00000479606	0.901	Clathrin heavy chain 1
16	9606.ENSP00000360076	0.895	SH3-containing GRB2-like protein 3-interacting protein 1
17	9606.ENSP00000473001	0.891	F-BAR domain only protein 1
18	9606.ENSP00000252891	0.889	Numb-like protein
19	9606.ENSP00000275493	0.888	Epidermal growth factor receptor
20	9606.ENSP00000300176	0.885	Arf-GAP domain and FG repeat-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0045296	0.487	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.970	regulation of biological process
GO:0050794	0.936	regulation of cellular process
GO:0051179	0.931	localization
GO:0006810	0.918	transport
GO:0051641	0.877	cellular localization
GO:0016192	0.856	vesicle-mediated transport
GO:0032502	0.841	developmental process
GO:0006897	0.835	endocytosis
GO:0032501	0.788	multicellular organismal process
GO:0051649	0.785	establishment of localization in cell
GO:0048856	0.782	anatomical structure development
GO:0007275	0.346	multicellular organism development
GO:0099003	0.306	vesicle-mediated transport in synapse
GO:0050896	0.303	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0005829	0.991	cytosol
GO:0032991	0.987	protein-containing complex
GO:0043226	0.975	organelle
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0031982	0.934	vesicle
GO:0098590	0.735	plasma membrane region
GO:0097708	0.615	intracellular vesicle
GO:0031410	0.607	cytoplasmic vesicle
GO:0098796	0.544	membrane protein complex
GO:0048475	0.518	coated membrane
GO:0005905	0.503	clathrin-coated pit
GO:0030117	0.486	membrane coat
GO:0030118	0.445	clathrin coat
GO:0098797	0.424	plasma membrane protein complex
GO:0030132	0.306	clathrin coat of coated pit
GO:0030659	0.305	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]