StarFunc result for job id Q9UBC3

User Input

>input (853 residues)
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREV
SSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPS
PRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGT
PQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWP
AMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRK
AMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKS
KVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTV
CCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRK
DWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGK
YVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPA
RKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVM
IDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNS
IKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR
HLFAPLKDYFACE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBC3	1.000	1.000	0.000	853	1.000	1.000	Q9UBC3.pdb.gz	DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B PE=1 SV=1
2	AFDB:Q1LZ50	0.323	0.603	2.026E-30	422	0.159	0.322	Q1LZ50.pdb.gz	DNM3L_RAT DNA (cytosine-5)-methyltransferase 3-like OS=Rattus norvegicus OX=10116 GN=Dnmt3l PE=2 SV=1
3	PDB:2pv0B	0.327	0.717	5.243E-29	347	0.159	0.392	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
4	PDB:6pa7N	0.216	0.825	1.127E-27	211	0.244	0.986	6pa7N.pdb.gz	Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B.
5	PDB:6fdfA	0.248	0.592	4.662E-12	325	0.068	0.178	6fdfA.pdb.gz	Structural insights into the stimulation of S. pombe Dnmt2 catalytic efficiency by the tRNA nucleoside queuosine.
6	PDB:7r78A	0.246	0.115	5.634E-7	1880	0.057	0.026	7r78A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
7	PDB:7r76A	0.232	0.112	7.485E-7	1834	0.060	0.028	7r76A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
8	PDB:7t02A	0.223	0.114	8.135E-6	1752	0.054	0.026	7t02A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
9	PDB:6h2vA	0.127	0.408	1.110E-4	210	0.038	0.152	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
10	AFDB:H9GXF8	0.095	0.067	1.156E-4	1248	0.075	0.051	H9GXF8.pdb.gz
11	PDB:5wp5A	0.131	0.226	1.316E-4	463	0.039	0.071	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
12	PDB:5wp4A	0.132	0.217	6.457E-4	485	0.039	0.068	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
13	PDB:2xvaA	0.131	0.455	6.834E-4	199	0.038	0.161	2xvaA.pdb.gz	Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
14	AFDB:O15117	0.052	0.056	9.977E-2	783	0.073	0.079	O15117.pdb.gz	FYB1_HUMAN FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2
15	AFDB:Q09811	0.125	0.088	1.056E-1	1328	0.140	0.090	Q09811.pdb.gz	HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rqh1 PE=1 SV=1
16	AFDB:Q9VWP5	0.055	0.023	2.210E-1	2486	0.072	0.025	Q9VWP5.pdb.gz	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
17	AFDB:A0A0B4K774	0.049	0.083	3.107E-1	477	0.042	0.075	A0A0B4K774.pdb.gz	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
18	AFDB:F8WAL6	0.048	0.073	3.481E-1	542	0.045	0.070	F8WAL6.pdb.gz	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
19	AFDB:Q66IV2	0.059	0.095	3.481E-1	503	0.053	0.089	Q66IV2.pdb.gz	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
20	AFDB:Q9SUA1	0.066	0.071	3.481E-1	763	0.074	0.083	Q9SUA1.pdb.gz	DEKP3_ARATH DEK domain-containing chromatin-associated protein 3 OS=Arabidopsis thaliana OX=3702 GN=DEK3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JYR2	0.0	1156	796	0.723	0.775	A0A0G2JYR2_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=2
2	A0A2R9YJL5	0.0	811	1456	0.447	0.262	A0A2R9YJL5_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb91 PE=1 SV=1
3	A0A8I6AVL3	0.0	1355	839	0.829	0.843	A0A8I6AVL3_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=1
4	A0A8J8XG14	0.0	1372	860	0.844	0.837	A0A8J8XG14_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=1
5	B0S581	0.0	810	1433	0.447	0.266	B0S581_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb91 PE=1 SV=1
6	O88508	0.0	824	908	0.463	0.435	DNM3A_MOUSE DNA (cytosine-5)-methyltransferase 3A OS=Mus musculus OX=10090 GN=Dnmt3a PE=1 SV=2
7	O88509	0.0	1360	859	0.839	0.834	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2
8	P0DOY1	0.0	1104	740	0.681	0.785	DNM3C_MOUSE DNA (cytosine-5)-methyltransferase 3C OS=Mus musculus OX=10090 GN=Dnmt3c PE=1 SV=2
9	Q1LZ51	0.0	1375	859	0.844	0.838	Q1LZ51_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=2 SV=1
10	Q1LZ53	0.0	825	908	0.464	0.436	DNM3A_RAT DNA (cytosine-5)-methyltransferase 3A OS=Rattus norvegicus OX=10116 GN=Dnmt3a PE=1 SV=1
11	Q4W5Z4	0.0	823	877	0.472	0.460	DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus OX=9031 GN=DNMT3A PE=2 SV=1
12	Q588C6	0.0	929	816	0.510	0.533	Q588C6_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb633 PE=1 SV=1
13	Q588C7	0.0	709	1448	0.411	0.242	Q588C7_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=dnmt3 PE=1 SV=1
14	Q9UBC3	0.0	1775	853	1.000	1.000	DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B PE=1 SV=1
15	Q9Y6K1	0.0	827	912	0.464	0.434	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4
16	Q9UJW3	1.76e-75	253	386	0.149	0.329	DNM3L_HUMAN DNA (cytosine-5)-methyltransferase 3-like OS=Homo sapiens OX=9606 GN=DNMT3L PE=1 SV=3
17	Q9CWR8	1.21e-71	244	421	0.147	0.297	DNM3L_MOUSE DNA (cytosine-5)-methyltransferase 3-like OS=Mus musculus OX=10090 GN=Dnmt3l PE=1 SV=1
18	Q1LZ50	4.44e-71	242	422	0.137	0.277	DNM3L_RAT DNA (cytosine-5)-methyltransferase 3-like OS=Rattus norvegicus OX=10116 GN=Dnmt3l PE=2 SV=1
19	Q9M548	5.20e-11	68.6	626	0.059	0.080	DRM2_ARATH DNA (cytosine-5)-methyltransferase DRM2 OS=Arabidopsis thaliana OX=3702 GN=DRM2 PE=1 SV=1
20	Q9LXE5	1.92e-10	67.0	624	0.060	0.082	DRM1L_ARATH DNA (cytosine-5)-methyltransferase DRM1 OS=Arabidopsis thaliana OX=3702 GN=DRM1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17980 ADD_DNMT3	3.8e-22	89.3	Cysteine rich ADD domain in DNMT3
2	PF00145 DNA_methylase	6.5e-13	60.3	C-5 cytosine-specific DNA methylase
3	PF00855 PWWP	1.1e-08	46.8	PWWP domain
4	PF08169 RBB1NT	5.5e+02	12.1	RBB1NT (NUC162) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008965732.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008960114.1	0.994	Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family
2	9597.XP_008950657.1	0.985	Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family
3	9597.XP_008972207.1	0.976	Enhancer of zeste 2 polycomb repressive complex 2 subunit
4	9597.XP_003823892.1	0.966	DNA (cytosine-5)-methyltransferase 3-like isoform X1
5	9597.XP_003828201.1	0.945	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
6	9597.XP_008960171.1	0.942	DNA (cytosine-5)-methyltransferase 1-like
7	9597.XP_003831864.1	0.925	Belongs to the adenosylhomocysteinase family.
8	9597.XP_003807628.1	0.918	Chromobox 5
9	9597.XP_003810957.1	0.916	Regulatory subunit of S-adenosylmethionine synthetase 2, an enzyme that catalyzes the formation of S-adenosylmethionine from methionine and ATP. Regulates MAT2A catalytic activity by changing its kinetic properties, increasing its affinity for L-methionine.
10	9597.XP_003816631.1	0.913	Catalyzes the formation of S-adenosylmethionine from methionine and ATP
11	9597.XP_003828277.1	0.910	Catalyzes the formation of S-adenosylmethionine from methionine and ATP
12	9597.XP_008961229.1	0.907	Adenosylhomocysteinase like 1
13	9597.XP_008964291.1	0.907	Adenosylhomocysteinase like 2
14	9597.XP_008958403.1	0.906	Belongs to the histone H2B family.
15	9597.XP_003822248.1	0.904	S-adenosylmethionine decarboxylase proenzyme
16	9597.XP_008974016.1	0.879	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
17	9597.XP_003804484.2	0.876	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
18	9597.XP_003805987.1	0.830	Polycomb protein SUZ12
19	9597.XP_003814967.1	0.824	H3 histone, family 3A
20	9597.XP_003820503.1	0.811	Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity).

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0008757	0.996	S-adenosylmethionine-dependent methyltransferase activity
GO:0009008	0.995	DNA-methyltransferase activity
GO:0003886	0.994	DNA (cytosine-5-)-methyltransferase activity
GO:0140110	0.967	transcription regulator activity
GO:0003712	0.918	transcription coregulator activity
GO:0003714	0.888	transcription corepressor activity
GO:1901363	0.827	heterocyclic compound binding
GO:0097159	0.827	organic cyclic compound binding
GO:0003676	0.806	nucleic acid binding
GO:0003677	0.782	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0043412	0.978	macromolecule modification
GO:0050896	0.969	response to stimulus
GO:0044260	0.969	cellular macromolecule metabolic process
GO:0090304	0.967	nucleic acid metabolic process
GO:0006304	0.951	DNA modification
GO:0032259	0.945	methylation
GO:0006306	0.920	DNA methylation
GO:0051716	0.915	cellular response to stimulus
GO:0032776	0.910	DNA methylation on cytosine
GO:0048518	0.862	positive regulation of biological process
GO:0070887	0.850	cellular response to chemical stimulus
GO:0048523	0.849	negative regulation of cellular process
GO:0010556	0.837	regulation of macromolecule biosynthetic process
GO:0031326	0.836	regulation of cellular biosynthetic process
GO:0051252	0.823	regulation of RNA metabolic process
GO:0006355	0.781	regulation of DNA-templated transcription
GO:0010033	0.777	response to organic substance
GO:0010605	0.720	negative regulation of macromolecule metabolic process
GO:0009893	0.716	positive regulation of metabolic process
GO:0006950	0.709	response to stress
GO:0010604	0.701	positive regulation of macromolecule metabolic process
GO:0031324	0.691	negative regulation of cellular metabolic process
GO:0051172	0.690	negative regulation of nitrogen compound metabolic process
GO:0006357	0.676	regulation of transcription by RNA polymerase II
GO:0010558	0.659	negative regulation of macromolecule biosynthetic process
GO:0031327	0.659	negative regulation of cellular biosynthetic process
GO:0051253	0.658	negative regulation of RNA metabolic process
GO:0045892	0.623	negative regulation of DNA-templated transcription
GO:0009628	0.580	response to abiotic stimulus
GO:0071840	0.499	cellular component organization or biogenesis
GO:0048522	0.492	positive regulation of cellular process
GO:0000122	0.470	negative regulation of transcription by RNA polymerase II
GO:0016043	0.447	cellular component organization
GO:0009719	0.409	response to endogenous stimulus
GO:0032501	0.368	multicellular organismal process
GO:1901700	0.363	response to oxygen-containing compound
GO:0032502	0.339	developmental process
GO:0048856	0.327	anatomical structure development
GO:0071310	0.323	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.994	protein-containing complex
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:1902494	0.925	catalytic complex
GO:0005694	0.890	chromosome
GO:0000785	0.756	chromatin
GO:0005737	0.755	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.999	Methyltransferases.
RHEA:13681	0.994	a 2'-deoxycytidine in DNA + S-adenosyl-L-methionine = a 5-methyl-2'-deoxycytidine in DNA + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.37	0.994	DNA (cytosine-5-)-methyltransferase.

[back to server]