StarFunc result for job id Q9UBC5

User Input

>input (1043 residues)
MPLLEGSVGVEDLVLLEPLVEESLLKNLQLRYENKEIYTYIGNVVISVNPYQQLPIYGPE
FIAKYQDYTFYELKPHIYALANVAYQSLRDRDRDQCILITGESGSGKTEASKLVMSYVAA
VCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVITN
YLLEKSRLVKQLKGERNFHIFYQLLAGADEQLLKALKLERDTTGYAYLNHEVSRVDGMDD
ASSFRAVQSAMAVIGFSEEEIRQVLEVTSMVLKLGNVLVADEFQASGIPASGIRDGRGVR
EIGEMVGLNSEEVERALCSRTMETAKEKVVTALNVMQAQYARDALAKNIYSRLFDWIVNR
INESIKVGIGEKKKVMGVLDIYGFEILEDNSFEQFVINYCNEKLQQVFIEMTLKEEQEEY
KREGIPWTKVDYFDNGIICKLIEHNQRGILAMLDEECLRPGVVSDSTFLAKLNQLFSKHG
HYESKVTQNAQRQYDHTMGLSCFRICHYAGKVTYNVTSFIDKNNDLLFRDLLQAMWKAQH
PLLRSLFPEGNPKQASLKRPPTAGAQFKSSVAILMKNLYSKSPNYIRCIKPNEHQQRGQF
SSDLVATQARYLGLLENVRVRRAGYAHRQGYGPFLERYRLLSRSTWPHWNGGDREGVEKV
LGELSMSSGELAFGKTKIFIRSPKTLFYLEEQRRLRLQQLATLIQKIYRGWRCRTHYQLM
RKSQILISSWFRGNMQKKCYGKIKASVLLIQAFVRGWKARKNYRKYFRSEAALTLADFIY
KSMVQKFLLGLKNNLPSTNVLDKTWPAAPYKCLSTANQELQQLFYQWKCKRFRDQLSPKQ
VEILREKLCASELFKGKKASYPQSVPIPFCGDYIGLQGNPKLQKLKGGEEGPVLMAEAVK
KVNRGNGKTSSRILLLTKGHVILTDTKKSQAKIVIGLDNVAGVSVTSLKDGLFSLHLSEM
SSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGP
AGGDNSKLRYKKKGSHCLEVTVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0I1S9	0.662	0.610	0.000	1136	0.591	0.542	B0I1S9.pdb.gz	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
2	AFDB:E9PDF6	0.669	0.632	0.000	1107	0.593	0.559	E9PDF6.pdb.gz	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
3	AFDB:O88329	0.807	0.807	0.000	1043	0.876	0.876	O88329.pdb.gz	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
4	AFDB:P47807	0.712	0.711	0.000	1045	0.640	0.639	P47807.pdb.gz	MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus OX=9031 GN=MYO1A PE=1 SV=2
5	AFDB:Q9UBC5	1.000	1.000	0.000	1043	1.000	1.000	Q9UBC5.pdb.gz	MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens OX=9606 GN=MYO1A PE=1 SV=1
6	AFDB:A0A286Y9H2	0.653	0.638	3.822E-100	1069	0.424	0.413	A0A286Y9H2.pdb.gz	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
7	AFDB:O00159	0.652	0.640	9.160E-100	1063	0.418	0.410	O00159.pdb.gz	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
8	AFDB:Q23979	0.656	0.661	1.659E-97	1035	0.420	0.423	Q23979.pdb.gz	MY61F_DROME Unconventional myosin IC OS=Drosophila melanogaster OX=7227 GN=Myo61F PE=1 SV=3
9	AFDB:A5PF48	0.612	0.622	2.504E-96	1026	0.403	0.409	A5PF48.pdb.gz	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
10	AFDB:E7F9L8	0.658	0.683	5.962E-93	1004	0.392	0.407	E7F9L8.pdb.gz	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
11	PDB:4pa0A	0.568	0.605	3.517E-56	974	0.251	0.269	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4anjA	0.538	0.563	1.056E-53	995	0.244	0.255	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
13	PDB:4pa0B	0.572	0.645	2.651E-53	920	0.248	0.282	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:6ycxB	0.554	0.700	1.101E-51	817	0.209	0.267	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
15	PDB:4p7hB	0.568	0.621	2.887E-50	952	0.244	0.267	4p7hB.pdb.gz
16	PDB:7mf3B	0.546	0.628	2.157E-43	896	0.272	0.317	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.513	0.556	3.104E-41	954	0.281	0.307	5tbyA.pdb.gz
18	PDB:4mk0A	0.090	0.144	3.941E-3	631	0.025	0.041	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3uzsA	0.087	0.145	4.126E-3	609	0.025	0.043	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:3pvuA	0.081	0.135	6.844E-3	609	0.025	0.043	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286Y9H2	823	1069	0.427	0.416	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
2	A0A2R8Q9G7	822	1068	0.427	0.417	A0A2R8Q9G7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=fj81f11 PE=1 SV=1
3	A0A3B3IU30	696	967	0.398	0.429	A0A3B3IU30_HUMAN Myosin IG OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=1
4	A5PF48	756	1026	0.412	0.419	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
5	B0I1S9	1200	1136	0.573	0.526	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
6	B0I1T2	694	1018	0.398	0.408	MYO1G_HUMAN Unconventional myosin-Ig OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=2
7	E7F5R7	823	1043	0.427	0.427	E7F5R7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1c PE=1 SV=3
8	E7F9L8	702	1004	0.384	0.398	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
9	E7FDV0	580	1117	0.301	0.281	E7FDV0_DANRE Myosin IEa OS=Danio rerio OX=7955 GN=myo1ea PE=3 SV=1
10	E9PDF6	1258	1107	0.593	0.558	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
11	E9Q634	597	1107	0.308	0.290	MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus OX=10090 GN=Myo1e PE=1 SV=1
12	F1PRN2	714	1006	0.384	0.398	MYO1D_CANLF Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2
13	F5H6E2	813	1039	0.420	0.422	F5H6E2_HUMAN Myosin IC OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=1
14	O00159	813	1063	0.420	0.412	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
15	O00160	585	1098	0.305	0.290	MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens OX=9606 GN=MYO1F PE=1 SV=3
16	O43795	1200	1136	0.573	0.526	MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3
17	O88329	1914	1043	0.876	0.876	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
18	O94832	715	1006	0.384	0.398	MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2
19	P22467	640	994	0.339	0.356	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
20	P34092	598	1111	0.308	0.289	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	11	17.9	AAA ATPase domain
2	PF13401 AAA_22	42	15.8	AAA domain
3	PF19063 DUF5759	2.7e+02	12.8	Family of unknown function (DUF5759)
4	PF00612 IQ	2.2e-05	34.8	IQ calmodulin-binding motif
5	PF00063 Myosin_head	3e-263	886.7	Myosin head (motor domain)
6	PF06017 Myosin_TH1	2e-41	153.3	Unconventional myosin tail, actin- and lipid-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393392

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265944	0.934	Myosin-IIIa
2	9606.ENSP00000358994	0.931	Unconventional myosin-VI
3	9606.ENSP00000253754	0.925	PDZ and LIM domain protein 4
4	9606.ENSP00000304283	0.912	Ras-related C3 botulinum toxin substrate 3
5	9606.ENSP00000458162	0.911	Actin, cytoplasmic 2
6	9606.ENSP00000352264	0.906	CD2-associated protein
7	9606.ENSP00000352834	0.906	Unconventional myosin-Ic
8	9606.ENSP00000367059	0.878	Espin
9	9606.ENSP00000331983	0.836	F-actin-uncapping protein LRRC16A
10	9606.ENSP00000289228	0.806	Beta-centractin
11	9606.ENSP00000358921	0.805	Alpha-centractin
12	9606.ENSP00000397459	0.760	Dual specificity protein phosphatase 22
13	9606.ENSP00000343690	0.724	Dihydropyrimidinase-related protein 3
14	9606.ENSP00000349960	0.724	Actin, cytoplasmic 1
15	9606.ENSP00000299106	0.720	Junctional adhesion molecule C
16	9606.ENSP00000367220	0.707	Actin-related protein 2
17	9606.ENSP00000252699	0.681	Alpha-actinin-4
18	9606.ENSP00000361636	0.679	Troponin C, skeletal muscle
19	9606.ENSP00000302100	0.637	Galectin-4
20	9606.ENSP00000480359	0.630	PDZ and LIM domain protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.991	cytoskeletal protein binding
GO:0003774	0.976	cytoskeletal motor activity
GO:0140657	0.967	ATP-dependent activity
GO:0003779	0.967	actin binding
GO:0000146	0.958	microfilament motor activity
GO:0044877	0.931	protein-containing complex binding
GO:0051015	0.856	actin filament binding
GO:0043167	0.638	ion binding
GO:0005543	0.632	phospholipid binding
GO:0043168	0.481	anion binding
GO:0035091	0.430	phosphatidylinositol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0032501	0.956	multicellular organismal process
GO:0003008	0.639	system process
GO:0007600	0.578	sensory perception
GO:0051179	0.564	localization
GO:0071840	0.518	cellular component organization or biogenesis
GO:0050789	0.487	regulation of biological process
GO:0016043	0.474	cellular component organization
GO:0050794	0.416	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0071944	0.998	cell periphery
GO:0042995	0.997	cell projection
GO:0005856	0.996	cytoskeleton
GO:0120025	0.994	plasma membrane bounded cell projection
GO:0005886	0.994	plasma membrane
GO:0015629	0.989	actin cytoskeleton
GO:0032991	0.987	protein-containing complex
GO:0005737	0.981	cytoplasm
GO:0098858	0.886	actin-based cell projection
GO:0005829	0.883	cytosol
GO:0043227	0.867	membrane-bounded organelle
GO:0098862	0.844	cluster of actin-based cell projections
GO:0099081	0.803	supramolecular polymer
GO:0099512	0.792	supramolecular fiber
GO:0005903	0.791	brush border
GO:0005902	0.733	microvillus
GO:0099513	0.713	polymeric cytoskeletal fiber
GO:0098590	0.710	plasma membrane region
GO:0005884	0.662	actin filament
GO:0016328	0.653	lateral plasma membrane
GO:0009925	0.637	basal plasma membrane
GO:0043231	0.510	intracellular membrane-bounded organelle
GO:0031252	0.359	cell leading edge
GO:0005634	0.356	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.958	myosin ATPase.

[back to server]