StarFunc result for job id Q9UBD3

User Input

>input (114 residues)
MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47992	0.832	0.832	2.437E-18	114	0.982	0.982	P47992.pdb.gz	XCL1_HUMAN Lymphotactin OS=Homo sapiens OX=9606 GN=XCL1 PE=1 SV=1
2	AFDB:P47993	0.654	0.654	1.582E-13	114	0.605	0.605	P47993.pdb.gz	XCL1_MOUSE Lymphotactin OS=Mus musculus OX=10090 GN=Xcl1 PE=2 SV=1
3	PDB:1j8iA	0.480	0.574	4.663E-12	93	0.798	0.978	1j8iA.pdb.gz
4	AFDB:O70460	0.561	0.589	3.953E-7	108	0.211	0.222	O70460.pdb.gz	CCL19_MOUSE C-C motif chemokine 19 OS=Mus musculus OX=10090 GN=Ccl19 PE=1 SV=1
5	AFDB:P10148	0.498	0.387	5.130E-7	148	0.263	0.203	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
6	AFDB:P51671	0.493	0.575	5.476E-7	97	0.228	0.268	P51671.pdb.gz	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
7	AFDB:P48298	0.496	0.579	5.844E-7	97	0.202	0.237	P48298.pdb.gz	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
8	AFDB:Q99731	0.567	0.655	5.844E-7	98	0.175	0.204	Q99731.pdb.gz	CCL19_HUMAN C-C motif chemokine 19 OS=Homo sapiens OX=9606 GN=CCL19 PE=1 SV=1
9	AFDB:D4ABS1	0.503	0.581	6.658E-7	98	0.254	0.296	D4ABS1.pdb.gz	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
10	AFDB:P80075	0.518	0.593	6.658E-7	99	0.254	0.293	P80075.pdb.gz	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
11	AFDB:O00175	0.510	0.490	7.585E-7	119	0.254	0.244	O00175.pdb.gz	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
12	PDB:1esrA	0.497	0.729	1.512E-5	76	0.193	0.289	1esrA.pdb.gz
13	PDB:2mp1A	0.503	0.715	2.547E-5	77	0.149	0.221	2mp1A.pdb.gz
14	PDB:1bo0A	0.466	0.675	5.944E-5	76	0.202	0.303	1bo0A.pdb.gz
15	PDB:2q8tB	0.449	0.772	6.771E-5	65	0.193	0.338	2q8tB.pdb.gz
16	PDB:2ra4B	0.438	0.752	1.480E-4	65	0.167	0.292	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
17	PDB:2jyoA	0.459	0.711	2.051E-4	70	0.193	0.314	2jyoA.pdb.gz
18	PDB:2mpmA	0.449	0.667	2.051E-4	74	0.202	0.311	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
19	PDB:1nr4E	0.512	0.822	2.336E-4	69	0.158	0.261	1nr4E.pdb.gz
20	PDB:7f1tA	0.482	0.133	3.454E-4	423	0.184	0.050	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBD3	2.20e-79	230	114	1.000	1.000	XCL2_HUMAN Cytokine SCM-1 beta OS=Homo sapiens OX=9606 GN=XCL2 PE=1 SV=1
2	P47992	1.25e-77	226	114	0.982	0.982	XCL1_HUMAN Lymphotactin OS=Homo sapiens OX=9606 GN=XCL1 PE=1 SV=1
3	P47993	1.76e-50	157	114	0.605	0.605	XCL1_MOUSE Lymphotactin OS=Mus musculus OX=10090 GN=Xcl1 PE=2 SV=1
4	Q9JKC0	3.60e-11	57.8	119	0.254	0.244	CCL24_MOUSE C-C motif chemokine 24 OS=Mus musculus OX=10090 GN=Ccl24 PE=2 SV=1
5	P48298	4.51e-11	57.0	97	0.246	0.289	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
6	P80075	1.67e-10	55.5	99	0.219	0.253	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
7	P97545	4.06e-10	54.3	97	0.193	0.227	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
8	P51671	5.48e-10	53.9	97	0.219	0.258	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
9	Q99616	6.25e-10	53.9	98	0.193	0.224	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
10	O00175	1.04e-09	53.9	119	0.254	0.244	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
11	P10148	1.34e-09	54.3	148	0.219	0.169	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
12	P13501	1.91e-08	50.1	91	0.184	0.231	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
13	Q16627	2.29e-08	49.7	93	0.193	0.237	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
14	Q9QXY8	3.52e-08	49.3	97	0.228	0.268	CCL7_RAT C-C motif chemokine 7 OS=Rattus norvegicus OX=10116 GN=Ccl7 PE=3 SV=1
15	P80098	3.96e-08	49.3	99	0.193	0.222	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
16	P16619	4.85e-08	48.9	93	0.202	0.247	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
17	Q9Y258	5.17e-08	48.9	94	0.211	0.255	CCL26_HUMAN C-C motif chemokine 26 OS=Homo sapiens OX=9606 GN=CCL26 PE=1 SV=1
18	P14844	6.06e-08	50.1	148	0.184	0.142	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
19	Q8NHW4	7.85e-08	48.5	92	0.246	0.304	CC4L_HUMAN C-C motif chemokine 4-like OS=Homo sapiens OX=9606 GN=CCL4L1 PE=1 SV=1
20	D4ABS1	1.80e-07	47.8	98	0.193	0.224	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	8.5e-09	46.8	Small cytokines (intecrine/chemokine), interleukin-8 like
2	PF16645 PHtD_u1	85	15.0	Unstructured region on Pneumococcal histidine triad protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310405	0.996	Chemokine XC receptor 1
2	9606.ENSP00000356792	0.909	Lymphotactin
3	9606.ENSP00000246657	0.745	C-C chemokine receptor type 7
4	9606.ENSP00000362795	0.738	C-X-C chemokine receptor type 3
5	9606.ENSP00000296140	0.735	C-C chemokine receptor type 1
6	9606.ENSP00000351059	0.728	CX3C chemokine receptor 1
7	9606.ENSP00000292301	0.722	C-C chemokine receptor type 2
8	9606.ENSP00000441600	0.722	C-C chemokine receptor type 3
9	9606.ENSP00000292303	0.720	C-C chemokine receptor type 5
10	9606.ENSP00000395704	0.715	C-X-C chemokine receptor type 6
11	9606.ENSP00000295683	0.705	C-X-C chemokine receptor type 1
12	9606.ENSP00000319635	0.705	C-X-C chemokine receptor type 2
13	9606.ENSP00000326432	0.705	C-C chemokine receptor type 8
14	9606.ENSP00000350256	0.693	C-C chemokine receptor type 9
15	9606.ENSP00000292174	0.684	C-X-C chemokine receptor type 5
16	9606.ENSP00000386884	0.681	C-X-C chemokine receptor type 4
17	9606.ENSP00000477908	0.666	C-C motif chemokine 3
18	9606.ENSP00000343952	0.664	Chemokine (C-C motif) receptor 6
19	9606.ENSP00000332504	0.663	C-C chemokine receptor type 10
20	9606.ENSP00000481357	0.657	C-C motif chemokine ligand 23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.304	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.996	cellular response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0023052	0.995	signaling
GO:0002376	0.989	immune system process
GO:0007154	0.989	cell communication
GO:0048522	0.988	positive regulation of cellular process
GO:0006935	0.985	chemotaxis
GO:0007165	0.982	signal transduction
GO:0050900	0.971	leukocyte migration
GO:0048583	0.969	regulation of response to stimulus
GO:0040017	0.967	positive regulation of locomotion
GO:0002684	0.967	positive regulation of immune system process
GO:0006950	0.966	response to stress
GO:0030334	0.965	regulation of cell migration
GO:0006952	0.964	defense response
GO:0070887	0.956	cellular response to chemical stimulus
GO:0030335	0.955	positive regulation of cell migration
GO:0032101	0.945	regulation of response to external stimulus
GO:0060326	0.943	cell chemotaxis
GO:0048584	0.936	positive regulation of response to stimulus
GO:0030595	0.930	leukocyte chemotaxis
GO:0002685	0.928	regulation of leukocyte migration
GO:0071674	0.903	mononuclear cell migration
GO:0030155	0.860	regulation of cell adhesion
GO:0002687	0.860	positive regulation of leukocyte migration
GO:0032501	0.859	multicellular organismal process
GO:0001817	0.840	regulation of cytokine production
GO:0022407	0.833	regulation of cell-cell adhesion
GO:0071677	0.825	positive regulation of mononuclear cell migration
GO:1903037	0.815	regulation of leukocyte cell-cell adhesion
GO:0048519	0.814	negative regulation of biological process
GO:0032103	0.810	positive regulation of response to external stimulus
GO:0006955	0.805	immune response
GO:0043269	0.793	regulation of monoatomic ion transport
GO:0048523	0.781	negative regulation of cellular process
GO:0006959	0.763	humoral immune response
GO:0051282	0.751	regulation of sequestering of calcium ion
GO:0050865	0.751	regulation of cell activation
GO:0051240	0.749	positive regulation of multicellular organismal process
GO:0044419	0.734	biological process involved in interspecies interaction between organisms
GO:0042127	0.727	regulation of cell population proliferation
GO:0050920	0.717	regulation of chemotaxis
GO:2000401	0.710	regulation of lymphocyte migration
GO:0010604	0.696	positive regulation of macromolecule metabolic process
GO:0009607	0.693	response to biotic stimulus
GO:0051241	0.693	negative regulation of multicellular organismal process
GO:1903038	0.664	negative regulation of leukocyte cell-cell adhesion
GO:0050863	0.659	regulation of T cell activation
GO:0051707	0.645	response to other organism
GO:0045785	0.644	positive regulation of cell adhesion
GO:0001819	0.631	positive regulation of cytokine production
GO:0050921	0.618	positive regulation of chemotaxis
GO:0002697	0.613	regulation of immune effector process
GO:0002699	0.603	positive regulation of immune effector process
GO:0050670	0.597	regulation of lymphocyte proliferation
GO:0050867	0.581	positive regulation of cell activation
GO:0019730	0.580	antimicrobial humoral response
GO:0002688	0.576	regulation of leukocyte chemotaxis
GO:0002683	0.575	negative regulation of immune system process
GO:0061844	0.569	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0002690	0.569	positive regulation of leukocyte chemotaxis
GO:0001906	0.568	cell killing
GO:0002706	0.565	regulation of lymphocyte mediated immunity
GO:0001818	0.565	negative regulation of cytokine production
GO:0042129	0.565	regulation of T cell proliferation
GO:0008284	0.556	positive regulation of cell population proliferation
GO:0046634	0.555	regulation of alpha-beta T cell activation
GO:0031341	0.551	regulation of cell killing
GO:0002819	0.551	regulation of adaptive immune response
GO:0003013	0.545	circulatory system process
GO:0002708	0.544	positive regulation of lymphocyte mediated immunity
GO:0002822	0.532	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0022409	0.509	positive regulation of cell-cell adhesion
GO:0002696	0.500	positive regulation of leukocyte activation
GO:0031640	0.498	killing of cells of another organism
GO:0002709	0.488	regulation of T cell mediated immunity
GO:0051251	0.470	positive regulation of lymphocyte activation
GO:0007267	0.454	cell-cell signaling
GO:2000403	0.454	positive regulation of lymphocyte migration
GO:0051050	0.424	positive regulation of transport
GO:0050778	0.424	positive regulation of immune response
GO:0050870	0.383	positive regulation of T cell activation
GO:0002711	0.372	positive regulation of T cell mediated immunity
GO:0006954	0.344	inflammatory response
GO:0007166	0.338	cell surface receptor signaling pathway
GO:0010033	0.319	response to organic substance
GO:0072676	0.308	lymphocyte migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.417	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]