StarFunc result for job id Q9UBD9

User Input

>input (225 residues)
MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGT
YLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGL
NRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQ
KMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QZM3	0.994	0.994	2.213E-30	225	0.969	0.969	Q9QZM3.pdb.gz	CLCF1_MOUSE Cardiotrophin-like cytokine factor 1 OS=Mus musculus OX=10090 GN=Clcf1 PE=1 SV=1
2	AFDB:F8W2M3	0.695	0.417	5.826E-10	380	0.440	0.261	F8W2M3.pdb.gz	F8W2M3_DANRE Cardiotrophin-like cytokine factor 1 OS=Danio rerio OX=7955 GN=clcf1 PE=3 SV=1
3	AFDB:P83714	0.712	0.780	1.223E-9	204	0.271	0.299	P83714.pdb.gz	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
4	AFDB:Q8NEV9	0.656	0.612	2.875E-6	243	0.240	0.222	Q8NEV9.pdb.gz	IL27A_HUMAN Interleukin-27 subunit alpha OS=Homo sapiens OX=9606 GN=IL27 PE=1 SV=2
5	AFDB:Q8K3I6	0.585	0.567	3.504E-6	234	0.204	0.197	Q8K3I6.pdb.gz	IL27A_MOUSE Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1
6	AFDB:Q16619	0.624	0.691	3.681E-6	201	0.187	0.209	Q16619.pdb.gz	CTF1_HUMAN Cardiotrophin-1 OS=Homo sapiens OX=9606 GN=CTF1 PE=1 SV=1
7	AFDB:Q60753	0.666	0.733	7.356E-6	203	0.231	0.256	Q60753.pdb.gz	CTF1_MOUSE Cardiotrophin-1 OS=Mus musculus OX=10090 GN=Ctf1 PE=2 SV=1
8	AFDB:P20294	0.620	0.691	2.410E-5	200	0.151	0.170	P20294.pdb.gz	CNTF_RAT Ciliary neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Cntf PE=1 SV=1
9	AFDB:P26441	0.621	0.694	2.532E-5	200	0.147	0.165	P26441.pdb.gz	CNTF_HUMAN Ciliary neurotrophic factor OS=Homo sapiens OX=9606 GN=CNTF PE=1 SV=1
10	AFDB:D3ZPW3	0.589	0.570	3.406E-5	234	0.209	0.201	D3ZPW3.pdb.gz	D3ZPW3_RAT Interleukin 27 OS=Rattus norvegicus OX=10116 GN=Il27 PE=4 SV=1
11	PDB:7u7nD	0.628	0.731	1.082E-4	191	0.182	0.215	7u7nD.pdb.gz
12	PDB:1cnt1	0.566	0.835	2.058E-4	150	0.142	0.213	1cnt1.pdb.gz
13	PDB:7zxkC	0.602	0.800	3.914E-4	166	0.169	0.229	7zxkC.pdb.gz
14	PDB:7z0lB	0.471	0.300	6.742E-4	370	0.133	0.081	7z0lB.pdb.gz
15	PDB:6o4oA	0.570	0.737	1.052E-3	169	0.187	0.249	6o4oA.pdb.gz
16	PDB:1cnt2	0.524	0.885	2.828E-3	130	0.129	0.223	1cnt2.pdb.gz
17	PDB:4cniC	0.532	0.684	1.246E-2	171	0.120	0.158	4cniC.pdb.gz
18	PDB:1bp3A	0.569	0.668	1.310E-2	186	0.093	0.113	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
19	PDB:1rw5A	0.572	0.637	2.044E-2	199	0.133	0.151	1rw5A.pdb.gz
20	PDB:2q7nB	0.511	0.625	2.617E-2	180	0.138	0.172	2q7nB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBD9	8.41e-167	460	225	1.000	1.000	CLCF1_HUMAN Cardiotrophin-like cytokine factor 1 OS=Homo sapiens OX=9606 GN=CLCF1 PE=1 SV=1
2	Q9QZM3	1.67e-162	449	225	0.969	0.969	CLCF1_MOUSE Cardiotrophin-like cytokine factor 1 OS=Mus musculus OX=10090 GN=Clcf1 PE=1 SV=1
3	F8W2M3	1.06e-35	131	380	0.311	0.184	F8W2M3_DANRE Cardiotrophin-like cytokine factor 1 OS=Danio rerio OX=7955 GN=clcf1 PE=3 SV=1
4	P83714	8.81e-17	77.8	204	0.236	0.260	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
5	Q60753	0.019	37.4	203	0.204	0.227	CTF1_MOUSE Cardiotrophin-1 OS=Mus musculus OX=10090 GN=Ctf1 PE=2 SV=1
6	Q63086	0.34	33.5	203	0.071	0.079	CTF1_RAT Cardiotrophin-1 OS=Rattus norvegicus OX=10116 GN=Ctf1 PE=2 SV=1
7	P21888	1.1	32.7	461	0.102	0.050	SYC_ECOLI Cysteine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=cysS PE=1 SV=2
8	Q16619	2.1	31.2	201	0.067	0.075	CTF1_HUMAN Cardiotrophin-1 OS=Homo sapiens OX=9606 GN=CTF1 PE=1 SV=1
9	Q15751	3.0	31.6	4861	0.102	0.005	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
10	Q61140	5.1	30.8	874	0.084	0.022	BCAR1_MOUSE Breast cancer anti-estrogen resistance protein 1 OS=Mus musculus OX=10090 GN=Bcar1 PE=1 SV=2
11	P35817	6.2	30.4	686	0.089	0.029	BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BDF1 PE=1 SV=3
12	Q63767	6.3	30.4	968	0.084	0.020	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
13	P56945	6.4	30.4	870	0.084	0.022	BCAR1_HUMAN Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=1 SV=2
14	Q6P5Z4	6.6	30.4	870	0.084	0.022	Q6P5Z4_HUMAN Breast cancer anti-estrogen resistance 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=2 SV=1
15	E9PZP8	6.9	30.4	4859	0.102	0.005	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
16	Q8NEV9	7.7	29.6	243	0.156	0.144	IL27A_HUMAN Interleukin-27 subunit alpha OS=Homo sapiens OX=9606 GN=IL27 PE=1 SV=2
17	Q6L4L4	8.1	30.0	875	0.084	0.022	SIZ1_ORYSJ E3 SUMO-protein ligase SIZ1 OS=Oryza sativa subsp. japonica OX=39947 GN=SIZ1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01110 CNTF	0.1	23.5	Ciliary neurotrophic factor
2	PF06875 PRF	9.1e-05	33.5	Plethodontid receptivity factor PRF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376188	0.999	Cytokine receptor-like factor 1
2	9606.ENSP00000368265	0.985	Ciliary neurotrophic factor receptor subunit alpha
3	9606.ENSP00000263409	0.913	Leukemia inhibitory factor receptor
4	9606.ENSP00000370698	0.904	Interleukin-6 receptor subunit beta
5	9606.ENSP00000355370	0.845	Ciliary neurotrophic factor
6	9606.ENSP00000371067	0.699	Tyrosine-protein kinase JAK2
7	9606.ENSP00000343204	0.686	Tyrosine-protein kinase JAK1
8	9606.ENSP00000431885	0.673	Non-receptor tyrosine-protein kinase TYK2
9	9606.ENSP00000279804	0.627	Cardiotrophin-1
10	9606.ENSP00000368716	0.613	N-alpha-acetyltransferase 16, NatA auxiliary subunit
11	9606.ENSP00000351422	0.607	Uncharacterized protein C19orf60
12	9606.ENSP00000215781	0.580	Oncostatin-M
13	9606.ENSP00000264563	0.570	Interleukin-11
14	9606.ENSP00000249075	0.550	Leukemia inhibitory factor
15	9606.ENSP00000274276	0.533	Oncostatin-M-specific receptor subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity
GO:0005127	0.999	ciliary neurotrophic factor receptor binding
GO:0008083	0.417	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0008284	0.993	positive regulation of cell population proliferation
GO:0042531	0.985	positive regulation of tyrosine phosphorylation of STAT protein
GO:0009987	0.972	cellular process
GO:0048584	0.970	positive regulation of response to stimulus
GO:1901215	0.967	negative regulation of neuron death
GO:0050793	0.960	regulation of developmental process
GO:0051240	0.947	positive regulation of multicellular organismal process
GO:0010628	0.936	positive regulation of gene expression
GO:0050865	0.913	regulation of cell activation
GO:0043067	0.902	regulation of programmed cell death
GO:0023051	0.901	regulation of signaling
GO:0010646	0.901	regulation of cell communication
GO:0050896	0.894	response to stimulus
GO:0043066	0.888	negative regulation of apoptotic process
GO:0051251	0.888	positive regulation of lymphocyte activation
GO:0007154	0.885	cell communication
GO:0023056	0.861	positive regulation of signaling
GO:0051716	0.850	cellular response to stimulus
GO:0043524	0.840	negative regulation of neuron apoptotic process
GO:0023052	0.830	signaling
GO:0070663	0.828	regulation of leukocyte proliferation
GO:0010647	0.820	positive regulation of cell communication
GO:0070665	0.809	positive regulation of leukocyte proliferation
GO:0007165	0.778	signal transduction
GO:0051094	0.775	positive regulation of developmental process
GO:0007166	0.757	cell surface receptor signaling pathway
GO:0002819	0.739	regulation of adaptive immune response
GO:0032502	0.719	developmental process
GO:0032501	0.719	multicellular organismal process
GO:0048856	0.705	anatomical structure development
GO:0050670	0.682	regulation of lymphocyte proliferation
GO:0050871	0.650	positive regulation of B cell activation
GO:0050671	0.626	positive regulation of lymphocyte proliferation
GO:0002697	0.624	regulation of immune effector process
GO:0002699	0.595	positive regulation of immune effector process
GO:0009966	0.589	regulation of signal transduction
GO:0002821	0.587	positive regulation of adaptive immune response
GO:0002822	0.575	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0045595	0.539	regulation of cell differentiation
GO:0002637	0.539	regulation of immunoglobulin production
GO:0019221	0.482	cytokine-mediated signaling pathway
GO:0002706	0.409	regulation of lymphocyte mediated immunity
GO:0019219	0.406	regulation of nucleobase-containing compound metabolic process
GO:0045935	0.403	positive regulation of nucleobase-containing compound metabolic process
GO:0002824	0.387	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002714	0.375	positive regulation of B cell mediated immunity
GO:0045597	0.354	positive regulation of cell differentiation
GO:0030154	0.342	cell differentiation
GO:0065008	0.314	regulation of biological quality
GO:0009967	0.307	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005576	0.999	extracellular region
GO:0012505	0.686	endomembrane system
GO:0043227	0.682	membrane-bounded organelle
GO:0005737	0.639	cytoplasm
GO:0005615	0.598	extracellular space
GO:0071944	0.581	cell periphery
GO:0043231	0.574	intracellular membrane-bounded organelle
GO:0005886	0.519	plasma membrane
GO:0070013	0.375	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]