StarFunc result for job id Q9UBE0

User Input

>input (346 residues)
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGV
KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE
SFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDY
FLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMA
PVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0R4	0.959	0.959	1.551E-70	346	1.000	1.000	A0A024R0R4.pdb.gz
2	PDB:1y8rA	0.897	0.988	1.763E-58	314	0.908	1.000	1y8rA.pdb.gz	Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
3	AFDB:Q6IQS6	0.924	0.919	3.404E-55	348	0.691	0.687	Q6IQS6.pdb.gz	SAE1_DANRE SUMO-activating enzyme subunit 1 OS=Danio rerio OX=7955 GN=sae1 PE=2 SV=1
4	AFDB:M0QZS6	0.742	0.964	1.008E-42	265	0.760	0.992	M0QZS6.pdb.gz	M0QZS6_HUMAN SUMO1 activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1
5	AFDB:Q7KJV5	0.888	0.911	1.062E-39	337	0.402	0.412	Q7KJV5.pdb.gz	Q7KJV5_DROME Ubiquitin-like protein activating enzyme N subunit OS=Drosophila melanogaster OX=7227 GN=Aos1 PE=2 SV=1
6	AFDB:Q8VY78	0.820	0.879	4.023E-33	322	0.315	0.339	Q8VY78.pdb.gz	SAE1A_ARATH SUMO-activating enzyme subunit 1A OS=Arabidopsis thaliana OX=3702 GN=SAE1A PE=1 SV=1
7	AFDB:Q06624	0.792	0.790	6.058E-33	347	0.306	0.305	Q06624.pdb.gz	RHC31_YEAST DNA damage tolerance protein RHC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AOS1 PE=1 SV=1
8	AFDB:P0DI12	0.798	0.860	1.425E-31	320	0.315	0.341	P0DI12.pdb.gz	SA1B1_ARATH SUMO-activating enzyme subunit 1B-1 OS=Arabidopsis thaliana OX=3702 GN=SAE1B-1 PE=1 SV=1
9	AFDB:P79064	0.786	0.881	3.427E-31	307	0.269	0.303	P79064.pdb.gz	RAD31_SCHPO DNA damage tolerance protein rad31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad31 PE=4 SV=1
10	AFDB:Q17820	0.838	0.845	5.471E-31	343	0.301	0.303	Q17820.pdb.gz	SAE1_CAEEL SUMO-activating enzyme subunit aos-1 OS=Caenorhabditis elegans OX=6239 GN=aos-1 PE=3 SV=1
11	AFDB:Q9DBK7	0.736	0.275	2.382E-25	977	0.306	0.108	Q9DBK7.pdb.gz	Q9DBK7_MOUSE E1 ubiquitin-activating enzyme OS=Mus musculus OX=10090 GN=Uba7 PE=1 SV=1
12	PDB:5l6iA	0.753	0.269	1.107E-23	1007	0.283	0.097	5l6iA.pdb.gz	Dissecting the Specificity of Adenosyl Sulfamate Inhibitors Targeting the Ubiquitin-Activating Enzyme.
13	PDB:7solA	0.737	0.263	2.061E-22	1011	0.266	0.091	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
14	PDB:7pvnB	0.727	0.266	3.291E-22	990	0.280	0.098	7pvnB.pdb.gz	Structures of UBA6 explain its dual specificity for ubiquitin and FAT10.
15	PDB:7k5jI	0.754	0.279	3.922E-22	979	0.277	0.098	7k5jI.pdb.gz	Crystal structures of an E1-E2-ubiquitin thioester mimetic reveal molecular mechanisms of transthioesterification.
16	PDB:6dc6C	0.721	0.260	7.912E-22	996	0.292	0.101	6dc6C.pdb.gz	Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity.
17	PDB:4ii3A	0.731	0.266	1.596E-21	986	0.243	0.085	4ii3A.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
18	PDB:2nvuA	0.753	0.501	1.692E-21	530	0.269	0.175	2nvuA.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
19	PDB:3dbrG	0.787	0.545	2.865E-21	508	0.272	0.185	3dbrG.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:2nvuB	0.542	0.247	1.850E-17	789	0.173	0.076	2nvuB.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBE0	0.0	711	346	1.000	1.000	SAE1_HUMAN SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1
2	Q6IQS6	2.88e-177	497	348	0.694	0.690	SAE1_DANRE SUMO-activating enzyme subunit 1 OS=Danio rerio OX=7955 GN=sae1 PE=2 SV=1
3	M0QX65	3.06e-148	417	205	0.590	0.995	M0QX65_HUMAN SUMO1 activating enzyme subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1
4	M0R054	8.03e-113	326	157	0.454	1.000	M0R054_HUMAN SUMO1 activating enzyme subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1
5	M0QZS6	5.63e-97	290	265	0.399	0.521	M0QZS6_HUMAN SUMO1 activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1
6	M0QYM8	5.51e-95	280	133	0.384	1.000	M0QYM8_HUMAN SUMO1 activating enzyme subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1
7	Q7KSM5	2.57e-73	232	337	0.393	0.404	Q7KSM5_DROME Activator of SUMO 1 OS=Drosophila melanogaster OX=7227 GN=Aos1 PE=1 SV=1
8	Q7KJV5	4.00e-73	231	337	0.393	0.404	Q7KJV5_DROME Ubiquitin-like protein activating enzyme N subunit OS=Drosophila melanogaster OX=7227 GN=Aos1 PE=2 SV=1
9	Q9VG70	1.19e-72	230	337	0.390	0.401	Q9VG70_DROME Smt3 activating enzyme 1 OS=Drosophila melanogaster OX=7227 GN=Aos1 PE=2 SV=2
10	M0R286	1.28e-67	209	98	0.283	1.000	M0R286_HUMAN SUMO1 activating enzyme subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1
11	Q06624	5.98e-56	187	347	0.335	0.334	RHC31_YEAST DNA damage tolerance protein RHC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AOS1 PE=1 SV=1
12	P0DI12	8.96e-52	176	320	0.335	0.362	SA1B1_ARATH SUMO-activating enzyme subunit 1B-1 OS=Arabidopsis thaliana OX=3702 GN=SAE1B-1 PE=1 SV=1
13	P0DI13	8.96e-52	176	320	0.335	0.362	SA1B2_ARATH SUMO-activating enzyme subunit 1B-2 OS=Arabidopsis thaliana OX=3702 GN=SAE1B-2 PE=1 SV=1
14	Q8VY78	3.79e-49	169	322	0.324	0.348	SAE1A_ARATH SUMO-activating enzyme subunit 1A OS=Arabidopsis thaliana OX=3702 GN=SAE1A PE=1 SV=1
15	Q17820	2.14e-43	154	343	0.309	0.312	SAE1_CAEEL SUMO-activating enzyme subunit aos-1 OS=Caenorhabditis elegans OX=6239 GN=aos-1 PE=3 SV=1
16	C8VMA9	3.76e-34	135	1033	0.329	0.110	C8VMA9_EMENI E1 ubiquitin activating enzyme (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10266 PE=3 SV=1
17	H3BJA7	6.77e-34	131	410	0.309	0.261	H3BJA7_MOUSE Ubiquitin-like modifier activating enzyme 7 OS=Mus musculus OX=10090 GN=Uba7 PE=1 SV=1
18	Q8BTN4	1.99e-32	130	905	0.309	0.118	Q8BTN4_MOUSE Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Mus musculus OX=10090 GN=Uba7 PE=2 SV=1
19	Q9DBK7	2.16e-32	130	977	0.309	0.110	Q9DBK7_MOUSE E1 ubiquitin-activating enzyme OS=Mus musculus OX=10090 GN=Uba7 PE=1 SV=1
20	P79064	3.47e-30	119	307	0.280	0.316	RAD31_SCHPO DNA damage tolerance protein rad31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad31 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00899 ThiF	3.3e-51	185.1	ThiF family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000011372

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000011014	0.998	Ubiquitin-like modifier activating enzyme 2
2	9601.ENSPPYP00000007864	0.993	Ubiquitin-conjugating enzyme E2I
3	9601.ENSPPYP00000000742	0.986	Uncharacterized protein
4	9601.ENSPPYP00000014619	0.986	Small ubiquitin-related modifier 1
5	9601.ENSPPYP00000012841	0.939	annotation not available
6	9601.ENSPPYP00000009997	0.898	Small ubiquitin-related modifier
7	9601.ENSPPYP00000020349	0.898	Small ubiquitin-related modifier
8	9601.ENSPPYP00000023118	0.898	annotation not available
9	9601.ENSPPYP00000023768	0.898	Small ubiquitin-like modifier 2
10	9601.ENSPPYP00000011779	0.831	Ubiquitin-conjugating enzyme E2M
11	9601.ENSPPYP00000012059	0.829	Proliferating cell nuclear antigen
12	9601.ENSPPYP00000008165	0.804	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
13	9601.ENSPPYP00000002437	0.784	Synthesizes selenophosphate from selenide and ATP.
14	9601.ENSPPYP00000007314	0.780	Deoxyuridine triphosphatase
15	9601.ENSPPYP00000003192	0.753	Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localization of BUB1. Regulates chromosome segregation during oocyte meiosis. The BUB1/BUB3 complex plays a role in the inhibition of anaphase-promoting complex or cyclosome (APC/C) when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20. This complex can also phosphorylat [...]
16	9601.ENSPPYP00000013235	0.751	Ring-box 1, E3 ubiquitin protein ligase
17	9601.ENSPPYP00000022019	0.748	Ubiquitin-related modifier 1
18	9601.ENSPPYP00000023516	0.740	Transcription and mRNA export factor ENY2
19	9601.ENSPPYP00000014892	0.736	Ubiquitin-conjugating enzyme E2F (putative)
20	9601.ENSPPYP00000000934	0.725	Interleukin enhancer-binding factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008641	1.000	ubiquitin-like modifier activating enzyme activity
GO:0046983	0.998	protein dimerization activity
GO:0030234	0.997	enzyme regulator activity
GO:0019899	0.997	enzyme binding
GO:0046982	0.993	protein heterodimerization activity
GO:0008047	0.991	enzyme activator activity
GO:0019948	0.385	SUMO activating enzyme activity
GO:0004839	0.334	ubiquitin activating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0043412	0.990	macromolecule modification
GO:0019538	0.990	protein metabolic process
GO:0018193	0.984	peptidyl-amino acid modification
GO:0050794	0.972	regulation of cellular process
GO:0032446	0.959	protein modification by small protein conjugation
GO:0019222	0.934	regulation of metabolic process
GO:0080090	0.912	regulation of primary metabolic process
GO:0051171	0.912	regulation of nitrogen compound metabolic process
GO:0016925	0.910	protein sumoylation
GO:0060255	0.908	regulation of macromolecule metabolic process
GO:0009987	0.832	cellular process
GO:1903320	0.703	regulation of protein modification by small protein conjugation or removal
GO:0048518	0.664	positive regulation of biological process
GO:0009893	0.585	positive regulation of metabolic process
GO:0033157	0.547	regulation of intracellular protein transport
GO:0010604	0.544	positive regulation of macromolecule metabolic process
GO:0044237	0.509	cellular metabolic process
GO:0051173	0.452	positive regulation of nitrogen compound metabolic process
GO:0048522	0.444	positive regulation of cellular process
GO:1903747	0.436	regulation of establishment of protein localization to mitochondrion
GO:1903533	0.411	regulation of protein targeting
GO:0051247	0.346	positive regulation of protein metabolic process
GO:0031323	0.306	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.987	protein-containing complex
GO:0140513	0.880	nuclear protein-containing complex
GO:1902494	0.878	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.-.-	1.000	Forming carbon-sulfur bonds.
EC:6.2.1.45	0.334	E1 ubiquitin-activating enzyme.

[back to server]