StarFunc result for job id Q9UBE8

User Input

>input (527 residues)
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6Q382	0.715	0.793	2.720E-60	475	0.615	0.682	Q6Q382.pdb.gz	Q6Q382_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=nlk PE=2 SV=1
2	AFDB:Q8QGV6	0.721	0.850	4.247E-60	447	0.647	0.763	Q8QGV6.pdb.gz	NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis OX=8355 GN=nlk.2 PE=1 SV=1
3	AFDB:Q23993	0.725	0.800	1.581E-56	477	0.581	0.642	Q23993.pdb.gz	Q23993_DROME Mitogen-activated protein kinase OS=Drosophila melanogaster OX=7227 GN=nmo PE=1 SV=1
4	AFDB:Q9U9Y8	0.708	0.591	1.437E-48	634	0.524	0.435	Q9U9Y8.pdb.gz	NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans OX=6239 GN=lit-1 PE=1 SV=1
5	AFDB:E9QEY0	0.590	0.293	1.600E-32	1080	0.324	0.158	E9QEY0.pdb.gz	E9QEY0_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=bmk1 PE=1 SV=1
6	AFDB:A9T142	0.594	0.826	2.758E-32	375	0.298	0.419	A9T142.pdb.gz	MPK4A_PHYPA Mitogen-activated protein kinase 4a OS=Physcomitrium patens OX=3218 GN=MPK4a PE=1 SV=1
7	AFDB:Q39026	0.589	0.777	6.727E-32	395	0.292	0.390	Q39026.pdb.gz	MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana OX=3702 GN=MPK6 PE=1 SV=1
8	AFDB:G9CU32	0.587	0.769	3.624E-31	397	0.307	0.408	G9CU32.pdb.gz	G9CU32_GOSHI Mitogen-activated protein kinase OS=Gossypium hirsutum OX=3635 GN=MPK6 PE=2 SV=1
9	AFDB:A9S9Q8	0.592	0.812	5.126E-31	380	0.283	0.392	A9S9Q8.pdb.gz	MPK4B_PHYPA Mitogen-activated protein kinase 4b OS=Physcomitrium patens OX=3218 GN=MPK4b PE=1 SV=1
10	AFDB:P42525	0.592	0.590	5.126E-31	529	0.300	0.299	P42525.pdb.gz	ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum OX=44689 GN=erkA PE=2 SV=2
11	PDB:7opmA	0.588	0.842	7.404E-29	362	0.277	0.403	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
12	PDB:6dtlB	0.568	0.826	1.994E-28	357	0.281	0.415	6dtlB.pdb.gz
13	PDB:2zoqA	0.582	0.858	6.545E-28	352	0.273	0.409	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
14	PDB:5bvdA	0.557	0.875	6.545E-28	330	0.262	0.418	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
15	PDB:7cgaA	0.574	0.857	8.384E-28	347	0.245	0.372	7cgaA.pdb.gz
16	PDB:2b9iA	0.555	0.852	2.686E-26	338	0.256	0.399	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
17	PDB:3gc8A	0.556	0.832	6.884E-26	347	0.269	0.409	3gc8A.pdb.gz	The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
18	PDB:2lgcA	0.563	0.815	3.042E-25	359	0.271	0.398	2lgcA.pdb.gz
19	PDB:2ewaA	0.540	0.845	7.060E-25	330	0.260	0.415	2ewaA.pdb.gz	NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
20	PDB:1jnkA	0.530	0.790	2.377E-23	346	0.233	0.355	1jnkA.pdb.gz	Crystal structure of JNK3: a kinase implicated in neuronal apoptosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A4D6K823	0.0	672	439	0.596	0.715	A0A4D6K823_DROME Mitogen-activated protein kinase OS=Drosophila melanogaster OX=7227 GN=nmo PE=3 SV=1
2	B3IWJ8	0.0	838	452	0.808	0.942	B3IWJ8_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=nlka PE=2 SV=1
3	E7F1L8	0.0	862	533	0.907	0.897	E7F1L8_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=nlka PE=3 SV=1
4	O54949	0.0	1087	527	0.998	0.998	NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus OX=10090 GN=Nlk PE=1 SV=2
5	Q23993	0.0	645	477	0.577	0.637	Q23993_DROME Mitogen-activated protein kinase OS=Drosophila melanogaster OX=7227 GN=nmo PE=1 SV=1
6	Q23994	0.0	661	434	0.586	0.712	Q23994_DROME Mitogen-activated protein kinase OS=Drosophila melanogaster OX=7227 GN=nmo PE=2 SV=1
7	Q6Q382	0.0	670	475	0.594	0.659	Q6Q382_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=nlk PE=2 SV=1
8	Q8IQ91	0.0	671	430	0.596	0.730	Q8IQ91_DROME Mitogen-activated protein kinase OS=Drosophila melanogaster OX=7227 GN=nmo PE=3 SV=1
9	Q8QGV6	0.0	695	447	0.622	0.734	NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis OX=8355 GN=nlk.2 PE=1 SV=1
10	Q8T030	0.0	645	414	0.571	0.727	Q8T030_DROME Mitogen-activated protein kinase OS=Drosophila melanogaster OX=7227 GN=nmo PE=2 SV=1
11	Q9U9Y8	0.0	543	634	0.491	0.409	NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans OX=6239 GN=lit-1 PE=1 SV=1
12	Q9UBE8	0.0	1088	527	1.000	1.000	NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens OX=9606 GN=NLK PE=1 SV=2
13	P42525	1.42e-96	304	529	0.273	0.272	ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum OX=44689 GN=erkA PE=2 SV=2
14	Q9LQQ9	2.70e-93	290	363	0.281	0.408	MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana OX=3702 GN=MPK13 PE=1 SV=1
15	Q9M1Z5	7.09e-93	290	393	0.273	0.366	MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana OX=3702 GN=MPK10 PE=1 SV=1
16	A9T142	1.23e-92	289	375	0.283	0.397	MPK4A_PHYPA Mitogen-activated protein kinase 4a OS=Physcomitrium patens OX=3218 GN=MPK4a PE=1 SV=1
17	Q39027	1.45e-91	286	368	0.281	0.402	MPK7_ARATH Mitogen-activated protein kinase 7 OS=Arabidopsis thaliana OX=3702 GN=MPK7 PE=1 SV=2
18	Q39024	2.11e-90	283	376	0.287	0.402	MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana OX=3702 GN=MPK4 PE=1 SV=2
19	G9CU32	2.15e-90	284	397	0.292	0.388	G9CU32_GOSHI Mitogen-activated protein kinase OS=Gossypium hirsutum OX=3635 GN=MPK6 PE=2 SV=1
20	A9S9Q8	2.99e-90	283	380	0.292	0.405	MPK4B_PHYPA Mitogen-activated protein kinase 4b OS=Physcomitrium patens OX=3218 GN=MPK4b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.57	20.8	ABC1 atypical kinase-like domain
2	PF13095 FTA2	1.1e+02	13.9	Kinetochore Sim4 complex subunit FTA2
3	PF12330 Haspin_kinase	1.4	19.4	Haspin like kinase domain
4	PF14531 Kinase-like	81	14.0	Kinase-like
5	PF00069 Pkinase	1.9e-60	216.1	Protein kinase domain
6	PF17667 Pkinase_fungal	0.17	22.2	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	3.1e-27	107.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008819812.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008841841.1	0.985	Lymphoid enhancer-binding factor 1 isoform X1
2	1026970.XP_008838179.1	0.983	Mitogen-activated protein kinase kinase kinase 7 isoform X1
3	1026970.XP_008838473.1	0.976	Transcription factor 7 like 1
4	1026970.XP_008828396.1	0.971	Transcription factor 7 like 2
5	1026970.XP_008847656.1	0.895	Catenin beta-1
6	1026970.XP_008826085.1	0.886	Transcription factor 7 isoform X1
7	1026970.XP_008852256.1	0.822	Non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
8	1026970.XP_008820301.1	0.820	MYB proto-oncogene, transcription factor
9	1026970.XP_008847595.1	0.819	Forkhead box O1
10	1026970.XP_008850665.1	0.816	Forkhead box protein O3
11	1026970.XP_008853813.1	0.812	Forkhead box O4
12	1026970.XP_008833643.1	0.801	Forkhead box protein O6
13	1026970.XP_008826488.1	0.778	Histone-lysine N-methyltransferase SETDB1 isoform X1
14	1026970.XP_008821720.1	0.733	Homeodomain-interacting protein kinase 2 isoform X1
15	1026970.XP_008844419.1	0.730	CREB binding protein
16	1026970.XP_008822470.1	0.723	SMAD family member 4
17	1026970.XP_008852986.1	0.720	Myb-related protein A isoform X1
18	1026970.XP_008823799.1	0.709	Uridine-cytidine kinase 1 isoform X1
19	1026970.XP_008833476.1	0.709	Junction plakoglobin
20	1026970.XP_008841533.1	0.709	Uridine-cytidine kinase 1 like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0097159	0.340	organic cyclic compound binding
GO:1901363	0.339	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.978	response to stimulus
GO:0023051	0.976	regulation of signaling
GO:0010646	0.976	regulation of cell communication
GO:0044237	0.971	cellular metabolic process
GO:0048518	0.968	positive regulation of biological process
GO:0018210	0.967	peptidyl-threonine modification
GO:0032502	0.963	developmental process
GO:0018107	0.962	peptidyl-threonine phosphorylation
GO:0030111	0.960	regulation of Wnt signaling pathway
GO:0048856	0.946	anatomical structure development
GO:0032501	0.944	multicellular organismal process
GO:0019222	0.892	regulation of metabolic process
GO:0007154	0.885	cell communication
GO:0060255	0.880	regulation of macromolecule metabolic process
GO:0023052	0.879	signaling
GO:0048519	0.869	negative regulation of biological process
GO:0080090	0.868	regulation of primary metabolic process
GO:0051171	0.868	regulation of nitrogen compound metabolic process
GO:0031323	0.867	regulation of cellular metabolic process
GO:0048523	0.863	negative regulation of cellular process
GO:0010468	0.854	regulation of gene expression
GO:0007275	0.836	multicellular organism development
GO:0019219	0.816	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.786	positive regulation of cellular process
GO:0009889	0.785	regulation of biosynthetic process
GO:0009893	0.785	positive regulation of metabolic process
GO:0031326	0.784	regulation of cellular biosynthetic process
GO:0010556	0.778	regulation of macromolecule biosynthetic process
GO:0030901	0.777	midbrain development
GO:0010604	0.761	positive regulation of macromolecule metabolic process
GO:0007165	0.746	signal transduction
GO:0051252	0.745	regulation of RNA metabolic process
GO:0030177	0.737	positive regulation of Wnt signaling pathway
GO:1903506	0.626	regulation of nucleic acid-templated transcription
GO:0006355	0.624	regulation of DNA-templated transcription
GO:0051173	0.575	positive regulation of nitrogen compound metabolic process
GO:0031325	0.561	positive regulation of cellular metabolic process
GO:0007166	0.544	cell surface receptor signaling pathway
GO:0051254	0.327	positive regulation of RNA metabolic process
GO:0009892	0.314	negative regulation of metabolic process
GO:0031328	0.310	positive regulation of cellular biosynthetic process
GO:0050793	0.309	regulation of developmental process
GO:0042221	0.301	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.991	cytoplasm
GO:0005654	0.991	nucleoplasm
GO:0005829	0.965	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]