StarFunc result for job id Q9UBF1

User Input

>input (373 residues)
MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPSSFSTSSS
LILGGPEEEEVPSGVIPNLTESIPSSPPQGPPQGPSQSPLSSCCSSFSWSSFSEESSSQK
GEDTGTCQGLPDSESSFTYTLDEKVAELVEFLLLKYEAEEPVTEAEMLMIVIKYKDYFPV
ILKRAREFMELLFGLALIEVGPDHFCVFANTVGLTDEGSDDEGMPENSLLIIILSVIFIK
GNCASEEVIWEVLNAVGVYAGREHFVYGEPRELLTKVWVQGHYLEYREVPHSSPPYYEFL
WGPRAHSESIKKKVLEFLAKLNNTVPSSFPSWYKDALKDVEERVQATIDTADDATVMASE
SLSVMSSNVSFSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBF1	1.000	1.000	8.353E-59	373	1.000	1.000	Q9UBF1.pdb.gz	MAGC2_HUMAN Melanoma-associated antigen C2 OS=Homo sapiens OX=9606 GN=MAGEC2 PE=1 SV=1
2	AFDB:P43364	0.311	0.281	1.624E-21	429	0.357	0.310	P43364.pdb.gz	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
3	AFDB:P43356	0.313	0.353	1.973E-20	314	0.343	0.408	P43356.pdb.gz	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
4	AFDB:P43365	0.309	0.350	1.611E-19	314	0.319	0.379	P43365.pdb.gz	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
5	AFDB:Q8N7X4	0.418	0.386	1.273E-17	407	0.327	0.300	Q8N7X4.pdb.gz	MAGB6_HUMAN Melanoma-associated antigen B6 OS=Homo sapiens OX=9606 GN=MAGEB6 PE=1 SV=2
6	AFDB:E9Q1Q4	0.266	0.331	6.234E-17	296	0.236	0.297	E9Q1Q4.pdb.gz	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
7	AFDB:Q9HCI5	0.263	0.110	1.676E-15	957	0.295	0.115	Q9HCI5.pdb.gz	MAGE1_HUMAN Melanoma-associated antigen E1 OS=Homo sapiens OX=9606 GN=MAGEE1 PE=1 SV=2
8	AFDB:Q9Y5V3	0.263	0.132	7.329E-15	778	0.273	0.131	Q9Y5V3.pdb.gz	MAGD1_HUMAN Melanoma-associated antigen D1 OS=Homo sapiens OX=9606 GN=MAGED1 PE=1 SV=3
9	AFDB:Q6PCZ4	0.265	0.114	8.210E-15	918	0.273	0.111	Q6PCZ4.pdb.gz	MAGE1_MOUSE Melanoma-associated antigen E1 OS=Mus musculus OX=10090 GN=Magee1 PE=1 SV=1
10	AFDB:Q96JG8	0.258	0.137	9.196E-15	741	0.252	0.127	Q96JG8.pdb.gz	MAGD4_HUMAN Melanoma-associated antigen D4 OS=Homo sapiens OX=9606 GN=MAGED4 PE=1 SV=3
11	PDB:7tveF	0.221	0.298	6.159E-4	270	0.086	0.119	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
12	PDB:7qcdE	0.239	0.329	2.272E-3	261	0.080	0.115	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
13	PDB:3cuqA	0.147	0.228	4.344E-2	219	0.072	0.123	3cuqA.pdb.gz
14	PDB:4a6dA	0.140	0.149	4.598E-2	345	0.048	0.052	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
15	PDB:7a6hO	0.143	0.111	5.451E-2	512	0.064	0.047	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
16	PDB:1w7pD	0.135	0.259	6.463E-2	171	0.078	0.170	1w7pD.pdb.gz
17	PDB:2fxaB	0.180	0.318	8.584E-2	180	0.067	0.139	2fxaB.pdb.gz
18	PDB:5hs7A	0.173	0.500	1.140E-1	102	0.040	0.147	5hs7A.pdb.gz
19	PDB:5h3rA	0.175	0.407	1.277E-1	141	0.035	0.092	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
20	PDB:3euhC	0.125	0.200	1.514E-1	206	0.067	0.121	3euhC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBF1	0.0	752	373	1.000	1.000	MAGC2_HUMAN Melanoma-associated antigen C2 OS=Homo sapiens OX=9606 GN=MAGEC2 PE=1 SV=1
2	O60732	5.17e-97	314	1142	0.426	0.139	MAGC1_HUMAN Melanoma-associated antigen C1 OS=Homo sapiens OX=9606 GN=MAGEC1 PE=1 SV=3
3	P43363	7.11e-86	266	369	0.378	0.382	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
4	O15481	8.88e-76	239	346	0.359	0.387	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
5	G5E962	6.72e-73	234	400	0.340	0.318	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
6	Q96M61	6.99e-73	232	343	0.351	0.382	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
7	P43364	1.58e-72	234	429	0.340	0.296	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
8	Q8TD91	2.28e-69	231	643	0.373	0.216	MAGC3_HUMAN Melanoma-associated antigen C3 OS=Homo sapiens OX=9606 GN=MAGEC3 PE=1 SV=1
9	O15480	5.17e-69	222	346	0.322	0.347	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
10	P43362	6.07e-69	221	315	0.351	0.416	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
11	Q1RN33	3.20e-68	219	317	0.365	0.429	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
12	P43358	3.38e-68	219	317	0.365	0.429	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
13	Q96LZ2	2.97e-66	215	347	0.370	0.398	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
14	Q8BQR7	3.05e-65	212	327	0.327	0.373	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
15	P43361	9.40e-65	210	318	0.365	0.428	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
16	P43357	2.76e-64	209	314	0.359	0.427	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
17	O15479	7.18e-62	203	319	0.287	0.335	MAGB2_HUMAN Melanoma-associated antigen B2 OS=Homo sapiens OX=9606 GN=MAGEB2 PE=1 SV=3
18	P43365	3.58e-61	201	314	0.349	0.414	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
19	P43360	6.31e-59	195	314	0.365	0.433	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1
20	A2A9R3	5.67e-57	196	556	0.284	0.191	MAGB4_MOUSE Melanoma-associated antigen B4 OS=Mus musculus OX=10090 GN=Mageb4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15119 APOC4	5.3e+02	12.3	Apolipoprotein C4
2	PF01454 MAGE	0.00013	33.3	MAGE homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354660

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253024	0.993	Transcription intermediary factor 1-beta
2	9606.ENSP00000359382	0.848	Circadian clock protein PASD1
3	9606.ENSP00000323191	0.839	Sarcoma antigen 1
4	9606.ENSP00000285879	0.790	Melanoma-associated antigen C1
5	9606.ENSP00000216225	0.758	E3 ubiquitin-protein ligase RBX1
6	9606.ENSP00000432305	0.738	Sperm surface protein Sp17
7	9606.ENSP00000289619	0.731	PAGE family member 5
8	9606.ENSP00000338796	0.720	Synovial sarcoma, X breakpoint 2
9	9606.ENSP00000300574	0.716	Adapter molecule crk
10	9606.ENSP00000366118	0.714	Protein SSX1
11	9606.ENSP00000332602	0.699	Cancer/testis antigen 1B
12	9606.ENSP00000469441	0.696	Cancer/testis antigen 1A
13	9606.ENSP00000346300	0.687	Crk-like protein
14	9606.ENSP00000340660	0.672	Epididymal sperm-binding protein 1
15	9606.ENSP00000470185	0.672	Cancer/testis antigen family 45 member A1
16	9606.ENSP00000358019	0.660	Non-structural maintenance of chromosomes element 4 homolog A
17	9606.ENSP00000351884	0.657	Sperm protein associated with the nucleus on the X chromosome C
18	9606.ENSP00000355421	0.638	G antigen 2A
19	9606.ENSP00000340914	0.635	Synaptotagmin-3
20	9606.ENSP00000375073	0.631	EP300-interacting inhibitor of differentiation 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.971	enzyme binding
GO:0044389	0.962	ubiquitin-like protein ligase binding
GO:0031625	0.933	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0008152	0.967	metabolic process
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0071704	0.956	organic substance metabolic process
GO:0051173	0.955	positive regulation of nitrogen compound metabolic process
GO:0006807	0.926	nitrogen compound metabolic process
GO:0044238	0.915	primary metabolic process
GO:0051247	0.905	positive regulation of protein metabolic process
GO:0050790	0.891	regulation of catalytic activity
GO:0050794	0.890	regulation of cellular process
GO:1903320	0.881	regulation of protein modification by small protein conjugation or removal
GO:0031401	0.838	positive regulation of protein modification process
GO:0043170	0.818	macromolecule metabolic process
GO:1901564	0.762	organonitrogen compound metabolic process
GO:0031398	0.762	positive regulation of protein ubiquitination
GO:0009987	0.752	cellular process
GO:0009056	0.733	catabolic process
GO:0051438	0.664	regulation of ubiquitin-protein transferase activity
GO:0048519	0.545	negative regulation of biological process
GO:0019538	0.514	protein metabolic process
GO:0031323	0.500	regulation of cellular metabolic process
GO:0048523	0.458	negative regulation of cellular process
GO:0010468	0.359	regulation of gene expression
GO:1901575	0.345	organic substance catabolic process
GO:0009057	0.335	macromolecule catabolic process
GO:0048522	0.310	positive regulation of cellular process
GO:1901565	0.310	organonitrogen compound catabolic process
GO:0019219	0.310	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]