StarFunc result for job id Q9UBF8

User Input

>input (816 residues)
MGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVK
LLHGGVAVSSRGTPLELVNGDGVDSEIRCLDDPPAQIREEEDEMGAAVASGTAKGARRRR
QNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLL
NMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRKLI
LSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSNLKRTASNPKVEN
EDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQRLISELSLLN
HKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPE
NRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCD
NISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEK
VRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKI
LVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGY
CLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGG
LDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSM
TEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1S8	0.730	0.720	0.000	828	1.000	0.986	A0A0B4J1S8.pdb.gz	A0A0B4J1S8_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1
2	AFDB:Q49GP3	0.804	0.787	1.304E-98	835	0.822	0.804	Q49GP3.pdb.gz	PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio OX=7955 GN=pi4kb PE=2 SV=2
3	AFDB:Q20077	0.601	0.734	1.942E-44	666	0.308	0.377	Q20077.pdb.gz	Q20077_CAEEL PI3K/PI4K domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pifk-1 PE=1 SV=2
4	AFDB:P54677	0.593	0.416	8.724E-37	1180	0.293	0.203	P54677.pdb.gz	PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum OX=44689 GN=pikD PE=3 SV=3
5	AFDB:Q9UW24	0.551	0.472	1.710E-35	956	0.276	0.235	Q9UW24.pdb.gz	PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PIKA PE=3 SV=1
6	AFDB:Q9UW20	0.581	0.487	7.225E-35	977	0.294	0.246	Q9UW20.pdb.gz	PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PIKALPHA PE=3 SV=1
7	AFDB:P39104	0.580	0.448	1.385E-34	1066	0.289	0.221	P39104.pdb.gz	PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIK1 PE=1 SV=1
8	AFDB:Q9FMJ0	0.587	0.432	2.656E-34	1121	0.294	0.214	Q9FMJ0.pdb.gz	P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana OX=3702 GN=PI4KB1 PE=1 SV=1
9	AFDB:Q580E2	0.576	0.800	1.287E-31	581	0.196	0.275	Q580E2.pdb.gz	Q580E2_TRYB2 Phosphatidylinositol 4-kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.290 PE=4 SV=1
10	AFDB:F1RCP0	0.507	0.207	5.055E-28	2059	0.180	0.071	F1RCP0.pdb.gz
11	PDB:5dxhD	0.443	0.372	2.252E-15	981	0.119	0.099	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
12	PDB:7mezA	0.470	0.393	2.359E-15	989	0.140	0.115	7mezA.pdb.gz
13	PDB:4yknA	0.455	0.315	2.589E-15	1205	0.120	0.081	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
14	PDB:6gy0A	0.451	0.448	2.976E-15	822	0.129	0.128	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
15	PDB:5itdA	0.457	0.379	3.584E-15	995	0.116	0.095	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
16	PDB:6pyuA	0.442	0.391	4.317E-15	930	0.136	0.119	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
17	PDB:7lq1A	0.445	0.387	4.738E-15	950	0.125	0.107	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
18	PDB:5dxtA	0.457	0.426	5.978E-15	879	0.113	0.105	5dxtA.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
19	PDB:5swpA	0.462	0.361	7.542E-15	1060	0.129	0.099	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
20	PDB:2y3aA	0.478	0.404	1.201E-14	976	0.135	0.113	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1S8	0.0	1694	828	1.000	0.986	A0A0B4J1S8_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1
2	O02810	0.0	1685	816	0.993	0.993	PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus OX=9913 GN=PI4KB PE=1 SV=2
3	O08561	0.0	1659	816	0.977	0.977	PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus OX=10116 GN=Pi4kb PE=1 SV=1
4	Q49GP3	0.0	1349	835	0.824	0.805	PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio OX=7955 GN=pi4kb PE=2 SV=2
5	Q9BKJ2	0.0	618	1338	0.413	0.252	Q9BKJ2_DROME Four wheel drive, isoform C OS=Drosophila melanogaster OX=7227 GN=fwd PE=2 SV=2
6	Q9UBF8	0.0	1693	816	1.000	1.000	PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1
7	Q9W0R8	0.0	619	1674	0.413	0.201	Q9W0R8_DROME Four wheel drive, isoform A OS=Drosophila melanogaster OX=7227 GN=fwd PE=2 SV=2
8	Q20077	7.83e-106	342	666	0.197	0.242	Q20077_CAEEL PI3K/PI4K domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pifk-1 PE=1 SV=2
9	P54677	3.40e-87	302	1180	0.168	0.116	PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum OX=44689 GN=pikD PE=3 SV=3
10	P39104	5.32e-80	280	1066	0.163	0.125	PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIK1 PE=1 SV=1
11	Q9UW20	3.09e-79	277	977	0.169	0.141	PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PIKALPHA PE=3 SV=1
12	Q9FMJ0	1.18e-78	277	1121	0.169	0.123	P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana OX=3702 GN=PI4KB1 PE=1 SV=1
13	Q9UW24	7.56e-77	270	956	0.168	0.143	PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PIKA PE=3 SV=1
14	Q0WPX9	7.57e-77	272	1116	0.168	0.123	P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana OX=3702 GN=PI4KB2 PE=2 SV=1
15	Q10366	1.59e-76	267	851	0.159	0.153	PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pik1 PE=1 SV=1
16	Q580E2	1.06e-69	242	581	0.194	0.272	Q580E2_TRYB2 Phosphatidylinositol 4-kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.290 PE=4 SV=1
17	P37297	3.64e-54	206	1900	0.132	0.057	STT4_YEAST Phosphatidylinositol 4-kinase STT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT4 PE=1 SV=1
18	P42356	1.07e-52	202	2102	0.129	0.050	PI4KA_HUMAN Phosphatidylinositol 4-kinase alpha OS=Homo sapiens OX=9606 GN=PI4KA PE=1 SV=4
19	O08662	1.50e-52	201	2096	0.126	0.049	PI4KA_RAT Phosphatidylinositol 4-kinase alpha OS=Rattus norvegicus OX=10116 GN=Pi4ka PE=1 SV=2
20	E9Q3L2	1.54e-52	201	2105	0.126	0.049	PI4KA_MOUSE Phosphatidylinositol 4-kinase alpha OS=Mus musculus OX=10090 GN=Pi4ka PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	83	13.7	ABC1 atypical kinase-like domain
2	PF13575 DUF4135	27	15.4	Domain of unknown function (DUF4135)
3	PF00454 PI3_PI4_kinase	1.5e-30	118.5	Phosphatidylinositol 3- and 4-kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261890	0.998	Ras-related protein Rab-11A
2	9606.ENSP00000361475	0.997	Neuronal calcium sensor 1
3	9606.ENSP00000355777	0.989	Golgi resident protein GCP60
4	9606.ENSP00000373713	0.979	Phosphatidylinositide phosphatase SAC1
5	9606.ENSP00000440005	0.978	ADP-ribosylation factor 1
6	9606.ENSP00000264380	0.976	1-phosphatidylinositol 3-phosphate 5-kinase
7	9606.ENSP00000466363	0.972	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
8	9606.ENSP00000357883	0.971	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
9	9606.ENSP00000255882	0.970	Phosphatidylinositol 4-kinase alpha
10	9606.ENSP00000265382	0.964	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
11	9606.ENSP00000359665	0.963	Phosphatidylinositol 4-kinase type 2-alpha
12	9606.ENSP00000264864	0.960	Phosphatidylinositol 4-kinase type 2-beta
13	9606.ENSP00000359050	0.960	UPF0668 protein C10orf76
14	9606.ENSP00000219789	0.955	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
15	9606.ENSP00000482548	0.951	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
16	9606.ENSP00000262039	0.939	Phosphatidylinositol 3-kinase catalytic subunit type 3
17	9606.ENSP00000373399	0.937	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
18	9606.ENSP00000306330	0.924	14-3-3 protein gamma
19	9606.ENSP00000361021	0.924	Phosphatase and tensin homolog
20	9606.ENSP00000356155	0.922	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004430	1.000	1-phosphatidylinositol 4-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.990	signaling
GO:0007154	0.988	cell communication
GO:0051716	0.983	cellular response to stimulus
GO:0007165	0.963	signal transduction
GO:0008152	0.823	metabolic process
GO:0071704	0.804	organic substance metabolic process
GO:0044238	0.797	primary metabolic process
GO:0044237	0.716	cellular metabolic process
GO:0071840	0.483	cellular component organization or biogenesis
GO:0006796	0.458	phosphate-containing compound metabolic process
GO:0016043	0.450	cellular component organization
GO:0051179	0.449	localization
GO:0046488	0.367	phosphatidylinositol metabolic process
GO:0045017	0.336	glycerolipid biosynthetic process
GO:0008654	0.335	phospholipid biosynthetic process
GO:0051234	0.316	establishment of localization
GO:0006810	0.308	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	0.999	cytosol
GO:0012505	0.993	endomembrane system
GO:0005886	0.969	plasma membrane
GO:0043227	0.949	membrane-bounded organelle
GO:0043229	0.946	intracellular organelle
GO:0043231	0.935	intracellular membrane-bounded organelle
GO:0031090	0.908	organelle membrane
GO:0031982	0.878	vesicle
GO:0098588	0.757	bounding membrane of organelle
GO:0005794	0.676	Golgi apparatus
GO:0097708	0.652	intracellular vesicle
GO:0031410	0.638	cytoplasmic vesicle
GO:0005768	0.599	endosome
GO:0000139	0.515	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19877	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ADP + H(+)
EC:2.7.1.67	1.000	1-phosphatidylinositol 4-kinase.

[back to server]