StarFunc result for job id Q9UBG0

User Input

>input (1479 residues)
MGPGRPAPAPWPRHLLRCVLLLGCLHLGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGARTSNISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQV
TYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDE
VMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPD
PTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEE
HFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDD
DIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFF
EHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRF
RWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQ
PPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQ
AFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAPGEPSGPSPAPSGNKPTSCAV
VLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLL
QKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVS
EEPLNYVGWQDGEPQQPGGCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGS
CPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQS
YEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWR
PGACTNITMGVVCKLPRAEQSSFSPSALPENPAALVVVLMAVLLLLALLTAALILYRRRQ
SIERGAFEGARYSRSSSSPTEATEKNILVSDMEMNEQQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7qsrA	0.468	0.514	0.000	1335	0.322	0.357	7qsrA.pdb.gz
2	AFDB:O60449	0.465	0.403	0.000	1722	0.310	0.266	O60449.pdb.gz	LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3
3	AFDB:P22897	0.461	0.468	0.000	1456	0.331	0.336	P22897.pdb.gz	MRC1_HUMAN Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1
4	AFDB:Q13018	0.481	0.486	0.000	1463	0.341	0.344	Q13018.pdb.gz	PLA2R_HUMAN Secretory phospholipase A2 receptor OS=Homo sapiens OX=9606 GN=PLA2R1 PE=1 SV=2
5	AFDB:Q4TU93	0.772	0.771	0.000	1480	0.903	0.902	Q4TU93.pdb.gz	MRC2_RAT C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1
6	AFDB:Q60767	0.463	0.403	0.000	1723	0.306	0.263	Q60767.pdb.gz	LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 GN=Ly75 PE=1 SV=2
7	AFDB:Q61830	0.456	0.463	0.000	1456	0.332	0.337	Q61830.pdb.gz	MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2
8	AFDB:Q62028	0.480	0.478	0.000	1487	0.330	0.328	Q62028.pdb.gz	PLA2R_MOUSE Secretory phospholipase A2 receptor OS=Mus musculus OX=10090 GN=Pla2r1 PE=1 SV=1
9	PDB:7jptA	0.448	0.496	3.451E-101	1327	0.300	0.334	7jptA.pdb.gz
10	AFDB:Q17452	0.085	0.387	6.502E-19	308	0.048	0.231	Q17452.pdb.gz	Q17452_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-52 PE=1 SV=1
11	AFDB:Q9XUA7	0.103	0.444	7.614E-19	295	0.043	0.214	Q9XUA7.pdb.gz	Q9XUA7_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-187 PE=1 SV=1
12	AFDB:P90732	0.083	0.218	2.555E-18	545	0.062	0.167	P90732.pdb.gz	P90732_CAEEL Cubilin OS=Caenorhabditis elegans OX=6239 GN=clec-41 PE=1 SV=1
13	PDB:1qddA	0.081	0.785	4.155E-10	144	0.026	0.264	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
14	PDB:4mthA	0.082	0.797	2.763E-9	139	0.027	0.288	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
15	PDB:1htnA	0.077	0.685	1.412E-8	156	0.024	0.224	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
16	PDB:5f2qB	0.082	0.818	3.110E-8	135	0.026	0.281	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
17	PDB:1gz2A	0.078	0.776	3.455E-8	139	0.024	0.252	1gz2A.pdb.gz
18	PDB:7wz8A	0.079	0.608	8.020E-8	180	0.026	0.211	7wz8A.pdb.gz
19	PDB:3bx4C	0.066	0.648	9.392E-8	134	0.026	0.291	3bx4C.pdb.gz
20	PDB:1bj3A	0.068	0.711	1.862E-7	129	0.026	0.295	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60449	0.0	708	1722	0.319	0.274	LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3
2	P22897	0.0	813	1456	0.333	0.338	MRC1_HUMAN Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1
3	Q13018	0.0	870	1463	0.348	0.351	PLA2R_HUMAN Secretory phospholipase A2 receptor OS=Homo sapiens OX=9606 GN=PLA2R1 PE=1 SV=2
4	Q4LDF5	0.0	702	1732	0.307	0.262	Q4LDF5_CHICK DEC-205 protein OS=Gallus gallus OX=9031 GN=DEC205 PE=2 SV=1
5	Q4TU93	0.0	2681	1480	0.902	0.901	MRC2_RAT C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1
6	Q60767	0.0	678	1723	0.302	0.259	LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 GN=Ly75 PE=1 SV=2
7	Q61830	0.0	833	1456	0.340	0.345	MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2
8	Q62028	0.0	842	1487	0.343	0.341	PLA2R_MOUSE Secretory phospholipase A2 receptor OS=Mus musculus OX=10090 GN=Pla2r1 PE=1 SV=1
9	Q64449	0.0	2694	1479	0.909	0.909	MRC2_MOUSE C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3
10	Q9UBG0	0.0	3057	1479	1.000	1.000	MRC2_HUMAN C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2
11	O14594	9.28e-26	118	1321	0.039	0.043	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
12	P55067	2.32e-25	117	1257	0.037	0.044	NCAN_RAT Neurocan core protein OS=Rattus norvegicus OX=10116 GN=Ncan PE=1 SV=1
13	P55066	2.35e-25	117	1268	0.037	0.043	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
14	Q61282	5.72e-24	112	2132	0.049	0.034	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
15	P07897	1.19e-23	112	2124	0.037	0.025	PGCA_RAT Aggrecan core protein OS=Rattus norvegicus OX=10116 GN=Acan PE=1 SV=2
16	P13608	7.28e-23	109	2364	0.036	0.022	PGCA_BOVIN Aggrecan core protein OS=Bos taurus OX=9913 GN=ACAN PE=1 SV=3
17	A0A2R8Q3K1	1.35e-22	107	635	0.034	0.079	A0A2R8Q3K1_DANRE Chondroitin sulfate proteoglycan 2 OS=Danio rerio OX=7955 GN=br146 PE=4 SV=1
18	P16112	2.12e-22	107	2530	0.035	0.021	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3
19	F1QDA1	3.06e-22	107	1547	0.035	0.034	F1QDA1_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=2
20	E7F537	5.16e-22	106	1509	0.034	0.033	E7F537_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	0.65	20.8	Chordopoxvirus A33R protein
2	PF00040 fn2	1.6e-12	58.5	Fibronectin type II domain
3	PF00059 Lectin_C	1.2e-145	487.8	Lectin C-type domain
4	PF05473 UL45	1.5e-11	55.9	UL45 protein, carbohydrate-binding C-type lectin-like
5	PF00193 Xlink	0.22	23.1	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339328	0.841	Urokinase plasminogen activator surface receptor
2	9606.ENSP00000455897	0.822	Macrophage mannose receptor 1
3	9606.ENSP00000283243	0.815	Secretory phospholipase A2 receptor
4	9606.ENSP00000361850	0.811	Urokinase-type plasminogen activator
5	9606.ENSP00000472305	0.724	Zinc finger protein 358
6	9606.ENSP00000479953	0.699	Volume-regulated anion channel subunit LRRC8E
7	9606.ENSP00000333769	0.698	Basigin
8	9606.ENSP00000362639	0.698	Rab9 effector protein with kelch motifs
9	9606.ENSP00000482306	0.683	Tetratricopeptide repeat protein 8
10	9606.ENSP00000464050	0.682	ATP-dependent RNA helicase DDX42
11	9606.ENSP00000309610	0.676	Methyltransferase-like protein 2A
12	9606.ENSP00000335246	0.672	Ectonucleoside triphosphate diphosphohydrolase 5
13	9606.ENSP00000483236	0.672	DDB1- and CUL4-associated factor 7
14	9606.ENSP00000308208	0.668	Matrix metalloproteinase-14
15	9606.ENSP00000252840	0.667	Zinc finger protein 557
16	9606.ENSP00000262432	0.657	Methyltransferase-like protein 2B
17	9606.ENSP00000450436	0.657	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
18	9606.ENSP00000238616	0.652	Serine/threonine-protein kinase Nek9
19	9606.ENSP00000354927	0.631	Mitogen-activated protein kinase kinase kinase 3
20	9606.ENSP00000300527	0.629	Collagen alpha-2(VI) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005518	1.000	collagen binding
GO:0038023	0.805	signaling receptor activity
GO:0019899	0.564	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0008152	0.985	metabolic process
GO:0032963	0.979	collagen metabolic process
GO:0032502	0.969	developmental process
GO:0032501	0.969	multicellular organismal process
GO:0001503	0.956	ossification
GO:0030154	0.939	cell differentiation
GO:0001649	0.891	osteoblast differentiation
GO:0065007	0.699	biological regulation
GO:0050789	0.666	regulation of biological process
GO:0009056	0.510	catabolic process
GO:0050896	0.467	response to stimulus
GO:0048856	0.433	anatomical structure development
GO:0050794	0.406	regulation of cellular process
GO:0071704	0.300	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.981	plasma membrane
GO:0030054	0.851	cell junction
GO:0005622	0.776	intracellular anatomical structure
GO:0005737	0.771	cytoplasm
GO:0043226	0.652	organelle
GO:0043229	0.623	intracellular organelle
GO:0043227	0.507	membrane-bounded organelle
GO:0043231	0.429	intracellular membrane-bounded organelle
GO:0070161	0.389	anchoring junction
GO:0030055	0.366	cell-substrate junction
GO:0005925	0.345	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]