StarFunc result for job id Q9UBG3

User Input

>input (495 residues)
MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRL
LDEDHTGTVEFKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSG
TEVGRAGKGQHYEGSSHRQSQQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQSQERIS
PQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTREQDRAHQTGETVTGSGTQTQAGATQ
TVEQDSSHQTGRTSKQTQEATNDQNRGTETHGQGRSQTSQAVTGGHAQIQAGTHTQTPTQ
TVEQDSSHQTGSTSTQTQESTNGQNRGTEIHGQGRSQTSQAVTGGHTQIQAGSHTETVEQ
DRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTGASTESGRQEWSST
HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
ITARELYSYLRSTKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBG3	1.000	1.000	1.038E-55	495	1.000	1.000	Q9UBG3.pdb.gz	CRNN_HUMAN Cornulin OS=Homo sapiens OX=9606 GN=CRNN PE=1 SV=1
2	AFDB:P97347	0.192	0.086	3.237E-8	1118	0.273	0.121	P97347.pdb.gz	RPTN_MOUSE Repetin OS=Mus musculus OX=10090 GN=Rptn PE=2 SV=2
3	AFDB:Q8CIU0	0.200	0.198	6.591E-7	501	0.196	0.194	Q8CIU0.pdb.gz	Q8CIU0_RAT Profilaggrin (Fragment) OS=Rattus norvegicus OX=10116 GN=Flg PE=4 SV=1
4	AFDB:Q8VHD8	0.198	0.041	3.152E-6	2496	0.226	0.045	Q8VHD8.pdb.gz	HORN_MOUSE Hornerin OS=Mus musculus OX=10090 GN=Hrnr PE=1 SV=1
5	PDB:5hloC	0.168	0.852	1.036E-5	93	0.061	0.323	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
6	AFDB:Q5D862	0.195	0.042	1.342E-5	2391	0.246	0.051	Q5D862.pdb.gz	FILA2_HUMAN Filaggrin-2 OS=Homo sapiens OX=9606 GN=FLG2 PE=1 SV=1
7	PDB:5csnA	0.178	0.890	2.617E-5	94	0.055	0.287	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
8	PDB:6zdyA	0.164	0.720	3.114E-5	108	0.044	0.204	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
9	AFDB:Q2VIS4	0.188	0.043	3.809E-5	2362	0.269	0.056	Q2VIS4.pdb.gz	FILA2_MOUSE Filaggrin-2 OS=Mus musculus OX=10090 GN=Flg2 PE=1 SV=2
10	PDB:7psqG	0.179	0.751	7.011E-5	108	0.046	0.213	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
11	PDB:2lucA	0.167	0.700	8.342E-5	105	0.057	0.267	2lucA.pdb.gz
12	PDB:2k2fA	0.169	0.775	1.181E-4	93	0.059	0.312	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
13	PDB:7nmiB	0.182	0.185	2.659E-4	488	0.067	0.068	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
14	PDB:2kayA	0.171	0.860	3.352E-4	92	0.042	0.228	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
15	PDB:7ui5A	0.149	0.567	3.552E-4	114	0.053	0.228	7ui5A.pdb.gz	Evolution avoids a pathological stabilizing interaction in the immune protein S100A9.
16	PDB:1k96A	0.168	0.875	3.764E-4	89	0.042	0.236	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
17	AFDB:Q05331	0.191	0.081	2.619E-3	1218	0.242	0.099	Q05331.pdb.gz	Q05331_HUMAN Profilaggrin (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
18	AFDB:A0A0G2JZW4	0.090	0.026	3.667	2308	0.174	0.037	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
19	AFDB:F1NNE8	0.095	0.076	4.624	660	0.149	0.112	F1NNE8.pdb.gz	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
20	AFDB:Q8MQS4	0.124	0.073	6.546	907	0.133	0.073	Q8MQS4.pdb.gz	Q8MQS4_DROME GH06923p OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBG3	0.0	983	495	1.000	1.000	CRNN_HUMAN Cornulin OS=Homo sapiens OX=9606 GN=CRNN PE=1 SV=1
2	Q6XPR3	1.93e-27	118	784	0.089	0.056	RPTN_HUMAN Repetin OS=Homo sapiens OX=9606 GN=RPTN PE=1 SV=1
3	Q8VHD8	4.90e-24	108	2496	0.075	0.015	HORN_MOUSE Hornerin OS=Mus musculus OX=10090 GN=Hrnr PE=1 SV=1
4	P97347	2.31e-23	106	1118	0.083	0.037	RPTN_MOUSE Repetin OS=Mus musculus OX=10090 GN=Rptn PE=2 SV=2
5	Q2VIS4	2.36e-23	106	2362	0.081	0.017	FILA2_MOUSE Filaggrin-2 OS=Mus musculus OX=10090 GN=Flg2 PE=1 SV=2
6	Q86YZ3	3.91e-23	106	2850	0.079	0.014	HORN_HUMAN Hornerin OS=Homo sapiens OX=9606 GN=HRNR PE=1 SV=2
7	A0A0B4J1F9	1.80e-20	97.8	1599	0.087	0.027	A0A0B4J1F9_MOUSE Trichohyalin OS=Mus musculus OX=10090 GN=Tchh PE=1 SV=1
8	Q5D862	9.68e-20	95.5	2391	0.085	0.018	FILA2_HUMAN Filaggrin-2 OS=Homo sapiens OX=9606 GN=FLG2 PE=1 SV=1
9	P20930	1.41e-16	85.9	4061	0.077	0.009	FILA_HUMAN Filaggrin OS=Homo sapiens OX=9606 GN=FLG PE=1 SV=3
10	Q07283	2.92e-16	84.7	1943	0.099	0.025	TRHY_HUMAN Trichohyalin OS=Homo sapiens OX=9606 GN=TCHH PE=1 SV=2
11	Q05331	4.48e-14	77.4	1218	0.075	0.030	Q05331_HUMAN Profilaggrin (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
12	A0A060WZ60	6.49e-13	66.6	96	0.065	0.333	A0A060WZ60_ONCMY Protein S100 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00063160001 PE=3 SV=1
13	P25815	1.21e-11	63.2	95	0.067	0.347	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
14	Q5XJJ5	3.59e-11	62.0	102	0.067	0.324	Q5XJJ5_DANRE Protein S100 OS=Danio rerio OX=7955 GN=zgc:101880 PE=2 SV=1
15	P80511	6.58e-10	58.2	92	0.059	0.315	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
16	Q91061	7.54e-10	57.8	92	0.063	0.337	S10I_ICTPU Ictacalcin OS=Ictalurus punctatus OX=7998 PE=2 SV=1
17	Q9PSF6	1.00e-09	57.8	92	0.063	0.337	Q9PSF6_ICTPU Protein S100 OS=Ictalurus punctatus OX=7998 PE=3 SV=1
18	W5UM31	1.07e-09	57.4	92	0.063	0.337	W5UM31_ICTPU Protein S100 OS=Ictalurus punctatus OX=7998 GN=S10I PE=2 SV=1
19	P79105	3.13e-09	56.2	92	0.059	0.315	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
20	Q8CIU0	6.06e-09	60.5	501	0.063	0.062	Q8CIU0_RAT Profilaggrin (Fragment) OS=Rattus norvegicus OX=10116 GN=Flg PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	2.5	18.9	EF hand
2	PF13405 EF-hand_6	1.9e+02	13.3	EF-hand domain
3	PF13499 EF-hand_7	1.8	20.4	EF-hand domain pair
4	PF13833 EF-hand_8	2	19.6	EF-hand domain pair
5	PF01023 S_100	1.4e-10	51.9	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271835

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298295	0.934	Protein DEPP1
2	9606.ENSP00000330391	0.715	Small proline-rich protein 3
3	9606.ENSP00000475216	0.689	Keratinocyte proline rich protein
4	9606.ENSP00000357779	0.642	Cysteine rich C-terminal 1
5	9606.ENSP00000334644	0.640	Late cornified envelope protein 3C
6	9606.ENSP00000422007	0.626	Alpha-actinin-3
7	9606.ENSP00000447650	0.583	Uncharacterized protein
8	9606.ENSP00000370867	0.582	Protein-glutamine gamma-glutamyltransferase E
9	9606.ENSP00000447537	0.579	Biogenesis of lysosome-related organelles complex 1 subunit 1
10	9606.ENSP00000357753	0.556	Involucrin
11	9606.ENSP00000202625	0.545	Protein-glutamine gamma-glutamyltransferase 6
12	9606.ENSP00000245206	0.541	Aspartate aminotransferase, mitochondrial
13	9606.ENSP00000359539	0.541	Aspartate aminotransferase, cytoplasmic
14	9606.ENSP00000448220	0.539	Keratin, type II cytoskeletal 4
15	9606.ENSP00000302579	0.503	Sciellin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.623	ion binding
GO:0046872	0.572	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.970	regulation of cellular process
GO:0050896	0.952	response to stimulus
GO:0019222	0.896	regulation of metabolic process
GO:0014066	0.881	regulation of phosphatidylinositol 3-kinase signaling
GO:0051092	0.872	positive regulation of NF-kappaB transcription factor activity
GO:0048518	0.862	positive regulation of biological process
GO:1902806	0.857	regulation of cell cycle G1/S phase transition
GO:0050678	0.855	regulation of epithelial cell proliferation
GO:0010837	0.836	regulation of keratinocyte proliferation
GO:1902808	0.831	positive regulation of cell cycle G1/S phase transition
GO:0009628	0.495	response to abiotic stimulus
GO:0006950	0.475	response to stress
GO:0007155	0.460	cell adhesion
GO:0032502	0.433	developmental process
GO:0048856	0.420	anatomical structure development
GO:0051716	0.392	cellular response to stimulus
GO:0009266	0.390	response to temperature stimulus
GO:0010033	0.360	response to organic substance
GO:0034097	0.328	response to cytokine
GO:0071345	0.321	cellular response to cytokine stimulus
GO:0008284	0.315	positive regulation of cell population proliferation
GO:0098609	0.312	cell-cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0070062	0.999	extracellular exosome
GO:0005829	0.962	cytosol
GO:0005886	0.869	plasma membrane
GO:0043231	0.729	intracellular membrane-bounded organelle
GO:0001533	0.480	cornified envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]