StarFunc result for job id Q9UBH0

User Input

>input (155 residues)
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILG
VQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWF
LCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QYY1	0.979	0.973	5.095E-28	156	0.910	0.904	Q9QYY1.pdb.gz	I36RA_MOUSE Interleukin-36 receptor antagonist protein OS=Mus musculus OX=10090 GN=IL36RN PE=1 SV=2
2	PDB:1md6A	0.964	0.970	1.595E-25	154	0.903	0.909	1md6A.pdb.gz
3	AFDB:Q8WWZ1	0.833	0.848	1.754E-14	152	0.400	0.408	Q8WWZ1.pdb.gz	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
4	AFDB:P25086	0.797	0.700	3.708E-14	178	0.432	0.376	P25086.pdb.gz	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
5	AFDB:P18510	0.842	0.743	5.391E-14	177	0.471	0.412	P18510.pdb.gz	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
6	PDB:5bowA	0.838	0.859	8.484E-14	151	0.413	0.424	5bowA.pdb.gz
7	AFDB:P25085	0.819	0.718	9.202E-14	178	0.458	0.399	P25085.pdb.gz	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
8	AFDB:Q9JLA2	0.836	0.812	1.136E-12	160	0.348	0.338	Q9JLA2.pdb.gz	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
9	AFDB:Q9D6Z6	0.854	0.731	1.565E-12	183	0.329	0.279	Q9D6Z6.pdb.gz	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
10	AFDB:Q9UHA7	0.863	0.848	1.742E-12	158	0.303	0.297	Q9UHA7.pdb.gz	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
11	AFDB:Q9NZH8	0.825	0.760	4.097E-12	169	0.297	0.272	Q9NZH8.pdb.gz	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
12	PDB:4izeA	0.852	0.868	4.203E-12	152	0.297	0.303	4izeA.pdb.gz
13	AFDB:Q9NZH6	0.828	0.601	2.808E-11	218	0.335	0.239	Q9NZH6.pdb.gz	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
14	PDB:1irpA	0.736	0.744	1.594E-10	153	0.471	0.477	1irpA.pdb.gz
15	PDB:6hpiA	0.717	0.705	1.974E-10	158	0.323	0.316	6hpiA.pdb.gz
16	PDB:4qd2C	0.625	0.360	2.268E-4	286	0.084	0.045	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:4qd2B	0.617	0.662	1.925E-3	143	0.110	0.119	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
18	PDB:3malA	0.554	0.492	2.260E-3	181	0.097	0.083	3malA.pdb.gz
19	PDB:3nbcA	0.591	0.616	2.953E-3	148	0.084	0.088	3nbcA.pdb.gz	Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAc beta 1-4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis
20	PDB:1t9fA	0.548	0.487	4.069E-3	178	0.090	0.079	1t9fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBH0	9.66e-115	323	155	1.000	1.000	I36RA_HUMAN Interleukin-36 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL36RN PE=1 SV=1
2	Q9QYY1	8.33e-103	293	156	0.910	0.904	I36RA_MOUSE Interleukin-36 receptor antagonist protein OS=Mus musculus OX=10090 GN=IL36RN PE=1 SV=2
3	P18510	8.19e-37	126	177	0.465	0.407	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
4	P25085	1.67e-35	123	178	0.452	0.393	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
5	P25086	1.52e-33	118	178	0.432	0.376	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
6	Q8WWZ1	3.66e-31	111	152	0.406	0.414	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
7	Q9JLA2	9.04e-16	72.0	160	0.303	0.294	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
8	Q9NZH8	6.40e-15	70.1	169	0.232	0.213	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
9	A3DTN3	2.83e-13	67.4	267	0.245	0.142	A3DTN3_9AVES Interleukin-1 OS=Anser anser OX=8843 PE=2 SV=1
10	A3DTN2	3.32e-13	67.0	267	0.245	0.142	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
11	O73909	3.32e-13	67.0	267	0.245	0.142	O73909_CHICK Interleukin-1 OS=Gallus gallus OX=9031 GN=il-1beta PE=1 SV=1
12	E9LHC8	3.53e-13	67.0	267	0.245	0.142	E9LHC8_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
13	F4ZWC1	3.83e-13	67.0	267	0.245	0.142	F4ZWC1_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
14	A3DTN5	6.42e-13	66.2	267	0.245	0.142	A3DTN5_MELGA Interleukin-1 OS=Meleagris gallopavo OX=9103 GN=IL1RN PE=2 SV=1
15	Q9UHA7	4.48e-12	62.4	158	0.232	0.228	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
16	A3DTN4	5.82e-12	63.5	269	0.323	0.186	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
17	Q9NZH6	6.01e-12	63.2	218	0.239	0.170	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
18	Q9D6Z6	7.71e-12	62.0	183	0.297	0.251	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
19	P21621	5.36e-10	58.2	266	0.284	0.165	IL1B_SHEEP Interleukin-1 beta OS=Ovis aries OX=9940 GN=IL1B PE=2 SV=2
20	M4WG34	6.80e-10	57.8	266	0.284	0.165	M4WG34_SHEEP Multifunctional fusion protein OS=Ovis aries OX=9940 GN=IL1b PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	5.2e-19	79.5	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376896

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264257	0.997	Interleukin-1 receptor-like 2
2	9606.ENSP00000259213	0.994	Interleukin-36 beta
3	9606.ENSP00000314807	0.982	Interleukin 1 receptor accessory protein
4	9606.ENSP00000403104	0.948	Single Ig IL-1-related receptor
5	9606.ENSP00000259205	0.942	Interleukin-36 gamma
6	9606.ENSP00000259211	0.926	Interleukin-36 alpha
7	9606.ENSP00000385675	0.790	Interleukin-6
8	9606.ENSP00000398698	0.745	Tumor necrosis factor
9	9606.ENSP00000458715	0.739	Caspase recruitment domain-containing protein 14
10	9606.ENSP00000376893	0.727	Interleukin-1 family member 10
11	9606.ENSP00000263339	0.706	Interleukin-1 alpha
12	9606.ENSP00000379891	0.682	AP-1 complex subunit sigma-3
13	9606.ENSP00000263341	0.667	Interleukin-1 beta
14	9606.ENSP00000386380	0.621	Interleukin-1 receptor type 1
15	9606.ENSP00000280357	0.611	Interleukin-18
16	9606.ENSP00000370842	0.611	Interleukin-33
17	9606.ENSP00000306512	0.601	Interleukin-8
18	9606.ENSP00000412237	0.582	Interleukin-10
19	9606.ENSP00000272895	0.568	ATP-binding cassette sub-family A member 12
20	9606.ENSP00000206765	0.566	Protein-glutamine gamma-glutamyltransferase K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030545	1.000	signaling receptor regulator activity
GO:0005126	1.000	cytokine receptor binding
GO:0019955	0.994	cytokine binding
GO:0030547	0.993	signaling receptor inhibitor activity
GO:0019838	0.992	growth factor binding
GO:0005125	0.986	cytokine activity
GO:0070851	0.334	growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0048519	0.993	negative regulation of biological process
GO:0010468	0.992	regulation of gene expression
GO:0048583	0.990	regulation of response to stimulus
GO:0050896	0.986	response to stimulus
GO:0050794	0.984	regulation of cellular process
GO:0006952	0.981	defense response
GO:0001817	0.971	regulation of cytokine production
GO:0010646	0.955	regulation of cell communication
GO:0001818	0.951	negative regulation of cytokine production
GO:0023051	0.948	regulation of signaling
GO:0009607	0.832	response to biotic stimulus
GO:0044419	0.831	biological process involved in interspecies interaction between organisms
GO:0048523	0.831	negative regulation of cellular process
GO:0009966	0.824	regulation of signal transduction
GO:0002376	0.817	immune system process
GO:0009987	0.809	cellular process
GO:0043207	0.809	response to external biotic stimulus
GO:0048518	0.797	positive regulation of biological process
GO:0006955	0.721	immune response
GO:0051707	0.684	response to other organism
GO:0010604	0.577	positive regulation of macromolecule metabolic process
GO:0060759	0.573	regulation of response to cytokine stimulus
GO:0048585	0.549	negative regulation of response to stimulus
GO:0007154	0.465	cell communication
GO:0023052	0.461	signaling
GO:0098542	0.418	defense response to other organism
GO:0042221	0.398	response to chemical
GO:0051716	0.392	cellular response to stimulus
GO:0048522	0.392	positive regulation of cellular process
GO:0010628	0.385	positive regulation of gene expression
GO:0009968	0.359	negative regulation of signal transduction
GO:0032649	0.347	regulation of type II interferon production
GO:0032501	0.341	multicellular organismal process
GO:0008152	0.336	metabolic process
GO:0071704	0.333	organic substance metabolic process
GO:0051240	0.328	positive regulation of multicellular organismal process
GO:0001819	0.324	positive regulation of cytokine production
GO:0001959	0.309	regulation of cytokine-mediated signaling pathway
GO:0006959	0.300	humoral immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005737	0.684	cytoplasm
GO:0071944	0.547	cell periphery
GO:0016020	0.515	membrane
GO:0043227	0.410	membrane-bounded organelle
GO:0005886	0.326	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]