StarFunc result for job id Q9UBI4

User Input

>input (398 residues)
MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGADVPQSWPSCLCHGLIS
FLGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLR
TRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLK
RPLREIQMEKLKISDQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQ
QLALHFLGGSMNSMAGGAPSPGPADTVEMVSEVEPPAPQVGARSSPKQPLAEGLLTALQP
FLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDVVVEMAEADLR
ALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBI4	1.000	1.000	3.564E-79	398	1.000	1.000	Q9UBI4.pdb.gz	STML1_HUMAN Stomatin-like protein 1 OS=Homo sapiens OX=9606 GN=STOML1 PE=1 SV=1
2	AFDB:Q8CI66	0.683	0.681	6.644E-70	399	0.892	0.890	Q8CI66.pdb.gz	STML1_MOUSE Stomatin-like protein 1 OS=Mus musculus OX=10090 GN=Stoml1 PE=2 SV=1
3	AFDB:G5ED76	0.438	0.421	4.468E-35	415	0.281	0.270	G5ED76.pdb.gz	G5ED76_CAEEL UNC-24 OS=Caenorhabditis elegans OX=6239 PE=3 SV=1
4	AFDB:H2KZ92	0.409	0.511	3.105E-22	317	0.193	0.243	H2KZ92.pdb.gz	H2KZ92_CAEEL Band 7 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mec-2 PE=1 SV=1
5	AFDB:G5ED08	0.439	0.597	1.500E-21	289	0.173	0.239	G5ED08.pdb.gz	G5ED08_CAEEL Band 7 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-1 PE=1 SV=1
6	AFDB:P27105	0.433	0.593	2.687E-21	288	0.171	0.236	P27105.pdb.gz	STOM_HUMAN Stomatin OS=Homo sapiens OX=9606 GN=STOM PE=1 SV=3
7	AFDB:P54116	0.425	0.590	9.694E-21	284	0.163	0.229	P54116.pdb.gz	STOM_MOUSE Stomatin OS=Mus musculus OX=10090 GN=Stom PE=1 SV=3
8	AFDB:Q9VWL0	0.378	0.427	1.298E-20	350	0.168	0.191	Q9VWL0.pdb.gz	Q9VWL0_DROME Mec2 OS=Drosophila melanogaster OX=7227 GN=Mec2 PE=1 SV=1
9	AFDB:Q9NP85	0.410	0.426	2.325E-20	383	0.191	0.198	Q9NP85.pdb.gz	PODO_HUMAN Podocin OS=Homo sapiens OX=9606 GN=NPHS2 PE=1 SV=1
10	AFDB:Q91X05	0.416	0.430	3.112E-20	385	0.191	0.197	Q91X05.pdb.gz	PODO_MOUSE Podocin OS=Mus musculus OX=10090 GN=Nphs2 PE=1 SV=2
11	PDB:7vhpG	0.340	0.442	1.872E-11	299	0.093	0.124	7vhpG.pdb.gz
12	PDB:7wi3B	0.346	0.486	3.362E-9	275	0.083	0.120	7wi3B.pdb.gz
13	PDB:4v60A	0.287	0.149	6.994E-6	812	0.083	0.041	4v60A.pdb.gz
14	PDB:7d4iSC	0.193	0.298	1.412E-3	242	0.083	0.136	7d4iSC.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
15	PDB:7pzyC	0.194	0.336	1.681E-3	214	0.063	0.117	7pzyC.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:7mq8NM	0.207	0.335	2.842E-3	233	0.053	0.090	7mq8NM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:4pdxA	0.212	0.141	3.013E-3	622	0.050	0.032	4pdxA.pdb.gz
18	PDB:4v8mA0	0.194	0.317	5.093E-3	218	0.055	0.101	4v8mA0.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:3ssoB	0.161	0.162	8.120E-3	394	0.060	0.061	3ssoB.pdb.gz	A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
20	PDB:3ssmB	0.141	0.154	1.373E-2	354	0.048	0.054	3ssmB.pdb.gz	A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CI66	0.0	689	399	0.892	0.890	STML1_MOUSE Stomatin-like protein 1 OS=Mus musculus OX=10090 GN=Stoml1 PE=2 SV=1
2	Q9UBI4	0.0	801	398	1.000	1.000	STML1_HUMAN Stomatin-like protein 1 OS=Homo sapiens OX=9606 GN=STOML1 PE=1 SV=1
3	A0A8I6GAW8	1.56e-36	135	266	0.158	0.237	A0A8I6GAW8_RAT Stomatin OS=Rattus norvegicus OX=10116 GN=Stom PE=1 SV=1
4	A0A8I5ZV26	1.70e-36	136	284	0.158	0.222	A0A8I5ZV26_RAT Stomatin OS=Rattus norvegicus OX=10116 GN=Stom PE=1 SV=1
5	Q5XI04	1.72e-36	136	284	0.158	0.222	Q5XI04_RAT Stomatin OS=Rattus norvegicus OX=10116 GN=Stom PE=1 SV=1
6	A0A8I5YCP1	2.34e-36	135	277	0.158	0.227	A0A8I5YCP1_RAT Stomatin OS=Rattus norvegicus OX=10116 GN=Stom PE=1 SV=1
7	P27105	9.37e-36	134	288	0.156	0.215	STOM_HUMAN Stomatin OS=Homo sapiens OX=9606 GN=STOM PE=1 SV=3
8	G5ED76	2.79e-35	136	415	0.264	0.253	G5ED76_CAEEL UNC-24 OS=Caenorhabditis elegans OX=6239 PE=3 SV=1
9	P54116	9.94e-35	131	284	0.153	0.215	STOM_MOUSE Stomatin OS=Mus musculus OX=10090 GN=Stom PE=1 SV=3
10	Q8TAV4	1.38e-34	131	291	0.166	0.227	STML3_HUMAN Stomatin-like protein 3 OS=Homo sapiens OX=9606 GN=STOML3 PE=1 SV=1
11	H2KZ92	4.07e-33	128	317	0.153	0.192	H2KZ92_CAEEL Band 7 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mec-2 PE=1 SV=1
12	Q8MQ74	5.68e-33	129	392	0.153	0.156	Q8MQ74_CAEEL Band 7 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mec-2 PE=1 SV=1
13	Q27433	1.66e-32	129	481	0.153	0.127	MEC2_CAEEL Mechanosensory protein 2 OS=Caenorhabditis elegans OX=6239 GN=mec-2 PE=1 SV=1
14	Q9VWL0	1.18e-31	125	350	0.151	0.171	Q9VWL0_DROME Mec2 OS=Drosophila melanogaster OX=7227 GN=Mec2 PE=1 SV=1
15	Q21190	1.96e-31	122	285	0.166	0.232	UNC1_CAEEL Protein unc-1 OS=Caenorhabditis elegans OX=6239 GN=unc-1 PE=1 SV=2
16	G5ED08	2.66e-31	122	289	0.151	0.208	G5ED08_CAEEL Band 7 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-1 PE=1 SV=1
17	Q6PE84	4.00e-31	122	287	0.156	0.216	STML3_MOUSE Stomatin-like protein 3 OS=Mus musculus OX=10090 GN=Stoml3 PE=1 SV=2
18	Q9NP85	3.67e-28	116	383	0.131	0.136	PODO_HUMAN Podocin OS=Homo sapiens OX=9606 GN=NPHS2 PE=1 SV=1
19	Q91X05	5.09e-27	112	385	0.128	0.132	PODO_MOUSE Podocin OS=Mus musculus OX=10090 GN=Nphs2 PE=1 SV=2
20	A4FVJ0	5.70e-18	87.0	391	0.113	0.115	A4FVJ0_DANRE NPHS2 stomatin family member, podocin OS=Danio rerio OX=7955 GN=nphs2l PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01145 Band_7	3.2e-11	55.1	SPFH domain / Band 7 family
2	PF01959 DHQS	2.4e+02	12.0	3-dehydroquinate synthase II
3	PF02036 SCP2	3.1e-14	64.6	SCP-2 sterol transfer family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442478

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382327	0.757	Epimerase family protein SDR39U1
2	9606.ENSP00000255324	0.735	RING finger protein 17
3	9606.ENSP00000371994	0.714	Protein NYNRIN
4	9606.ENSP00000324302	0.698	Syntaxin-binding protein 6
5	9606.ENSP00000337040	0.697	Protein unc-119 homolog A
6	9606.ENSP00000225823	0.690	Acid sensing ion channel subunit 2
7	9606.ENSP00000261921	0.686	Lysyl oxidase homolog 1
8	9606.ENSP00000366645	0.678	SCP2 sterol-binding domain-containing protein 1
9	9606.ENSP00000320520	0.653	Leucine-rich repeat-containing protein 75B
10	9606.ENSP00000442477	0.628	Acid-sensing ion channel 5
11	9606.ENSP00000264079	0.625	Mucolipin-1
12	9606.ENSP00000273375	0.594	Rab-like protein 3
13	9606.ENSP00000292363	0.594	E3 ubiquitin-protein ligase RNF126
14	9606.ENSP00000326627	0.586	Acid-sensing ion channel 4
15	9606.ENSP00000256339	0.579	Protein unc-79 homolog
16	9606.ENSP00000391088	0.547	Protein unc-80 homolog
17	9606.ENSP00000286713	0.536	Erythrocyte band 7 integral membrane protein
18	9606.ENSP00000297512	0.519	Acid-sensing ion channel 3
19	9606.ENSP00000216338	0.516	Granzyme H
20	9606.ENSP00000265627	0.510	Serum paraoxonase/lactonase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.803	molecular function regulator activity
GO:0016247	0.734	channel regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.992	biological regulation
GO:0051716	0.983	cellular response to stimulus
GO:0050794	0.983	regulation of cellular process
GO:0048519	0.973	negative regulation of biological process
GO:0048523	0.944	negative regulation of cellular process
GO:0042221	0.937	response to chemical
GO:0007165	0.936	signal transduction
GO:0032879	0.915	regulation of localization
GO:0010033	0.914	response to organic substance
GO:0032409	0.893	regulation of transporter activity
GO:0034762	0.889	regulation of transmembrane transport
GO:0051051	0.881	negative regulation of transport
GO:0043269	0.880	regulation of monoatomic ion transport
GO:0070887	0.840	cellular response to chemical stimulus
GO:0071310	0.812	cellular response to organic substance
GO:0043271	0.775	negative regulation of monoatomic ion transport
GO:0044092	0.774	negative regulation of molecular function
GO:0034765	0.769	regulation of monoatomic ion transmembrane transport
GO:0034763	0.762	negative regulation of transmembrane transport
GO:0034097	0.756	response to cytokine
GO:0032412	0.753	regulation of monoatomic ion transmembrane transporter activity
GO:0032410	0.751	negative regulation of transporter activity
GO:1904062	0.750	regulation of monoatomic cation transmembrane transport
GO:0002028	0.745	regulation of sodium ion transport
GO:2000649	0.729	regulation of sodium ion transmembrane transporter activity
GO:0034766	0.711	negative regulation of monoatomic ion transmembrane transport
GO:1904063	0.685	negative regulation of cation transmembrane transport
GO:0032413	0.685	negative regulation of ion transmembrane transporter activity
GO:1990823	0.669	response to leukemia inhibitory factor
GO:0071345	0.644	cellular response to cytokine stimulus
GO:0007178	0.614	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1990830	0.509	cellular response to leukemia inhibitory factor
GO:0035556	0.487	intracellular signal transduction
GO:0008152	0.363	metabolic process
GO:2001257	0.341	regulation of cation channel activity
GO:0071704	0.330	organic substance metabolic process
GO:0051179	0.301	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0031982	0.961	vesicle
GO:0097708	0.806	intracellular vesicle
GO:0043233	0.714	organelle lumen
GO:0031410	0.649	cytoplasmic vesicle
GO:0070013	0.512	intracellular organelle lumen
GO:0012505	0.432	endomembrane system
GO:0031981	0.418	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]