StarFunc result for job id Q9UBK2

User Input

>input (798 residues)
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
DSLDFDSLLKEAQRSLRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9Q9	0.203	0.203	0.000	798	1.000	1.000	A0A024R9Q9.pdb.gz
2	AFDB:F1QXB5	0.262	0.248	6.741E-63	859	0.586	0.545	F1QXB5.pdb.gz
3	AFDB:D7F2U9	0.197	0.187	1.121E-56	844	0.580	0.549	D7F2U9.pdb.gz
4	AFDB:Q86YN6	0.133	0.109	1.336E-23	1023	0.336	0.262	Q86YN6.pdb.gz	PRGC2_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=2
5	AFDB:Q5VV67	0.163	0.083	9.083E-20	1664	0.248	0.119	Q5VV67.pdb.gz	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
6	PDB:6qx91K	0.092	0.344	1.005E-5	201	0.043	0.169	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
7	PDB:3lqvB	0.096	0.595	1.905E-5	115	0.020	0.139	3lqvB.pdb.gz	Branch Recognition by SF3b14
8	AFDB:Q9P789	0.086	0.065	4.185E-5	1065	0.138	0.103	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
9	PDB:5yzg1	0.088	0.277	6.421E-5	243	0.021	0.070	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
10	PDB:5oobB	0.096	0.453	6.845E-5	152	0.020	0.105	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
11	PDB:1hl6A	0.087	0.534	7.779E-5	119	0.024	0.160	1hl6A.pdb.gz
12	PDB:6n7pA	0.088	0.335	9.424E-5	186	0.038	0.161	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
13	PDB:5vsuA	0.104	0.207	1.676E-4	387	0.025	0.052	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
14	PDB:5xjcw	0.087	0.675	1.904E-4	91	0.023	0.198	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
15	PDB:6n7pY	0.091	0.481	1.904E-4	138	0.021	0.123	6n7pY.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
16	PDB:6c0fo	0.069	0.387	3.176E-4	133	0.023	0.135	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
17	AFDB:Q8C9B9	0.042	0.020	2.350E-2	2256	0.168	0.059	Q8C9B9.pdb.gz	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
18	AFDB:Q8T145	0.044	0.026	4.179E-2	1789	0.144	0.064	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
19	AFDB:Q3UHK8	0.089	0.040	4.749E-2	1896	0.150	0.063	Q3UHK8.pdb.gz	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
20	AFDB:A0A0R4IJ26	0.093	0.050	7.430E-2	1760	0.154	0.070	A0A0R4IJ26.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70343	0.0	1402	797	0.946	0.947	PRGC1_MOUSE Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Mus musculus OX=10090 GN=Ppargc1a PE=1 SV=1
2	Q9QYK2	0.0	1414	796	0.951	0.954	PRGC1_RAT Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Rattus norvegicus OX=10116 GN=Ppargc1a PE=2 SV=1
3	Q9UBK2	0.0	1638	798	1.000	1.000	PRGC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Homo sapiens OX=9606 GN=PPARGC1A PE=1 SV=1
4	X6R7H2	7.25e-51	191	631	0.104	0.132	X6R7H2_HUMAN PPARG related coactivator 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
5	Q5VV67	6.06e-50	193	1664	0.104	0.050	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
6	E7EVG6	7.49e-50	192	1400	0.104	0.059	E7EVG6_HUMAN PPARG related coactivator 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
7	Q86YN6	3.35e-31	134	1023	0.085	0.066	PRGC2_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=2
8	Q811R2	1.48e-28	125	1010	0.080	0.063	PRGC2_RAT Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Rattus norvegicus OX=10116 GN=Ppargc1b PE=2 SV=2
9	Q8VHJ7	1.60e-28	125	1014	0.085	0.067	PRGC2_MOUSE Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Mus musculus OX=10090 GN=Ppargc1b PE=1 SV=1
10	H0Y713	6.12e-18	90.9	748	0.056	0.060	H0Y713_HUMAN PPARG coactivator 1 beta (Fragment) OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=1
11	Q8IPM0	7.29e-18	91.3	1058	0.050	0.038	Q8IPM0_DROME Spargel, isoform D OS=Drosophila melanogaster OX=7227 GN=srl PE=4 SV=3
12	Q5U183	7.42e-18	91.3	1058	0.050	0.038	Q5U183_DROME RE24187p OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=1
13	Q8IPM1	7.71e-18	91.3	1067	0.050	0.037	Q8IPM1_DROME FI18188p1 OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=2
14	Q8IH74	6.12e-17	87.4	555	0.049	0.070	Q8IH74_DROME GH02708p OS=Drosophila melanogaster OX=7227 GN=srl PE=2 SV=1
15	G5EA30	0.002	43.9	514	0.028	0.043	G5EA30_HUMAN CUG triplet repeat, RNA binding protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=1
16	M0QY66	0.002	44.3	484	0.028	0.045	M0QY66_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens OX=9606 GN=CELF4 PE=1 SV=1
17	Q7TSY6	0.002	44.3	486	0.030	0.049	CELF4_MOUSE CUGBP Elav-like family member 4 OS=Mus musculus OX=10090 GN=Celf4 PE=1 SV=2
18	Q9BZC1	0.002	44.3	486	0.030	0.049	CELF4_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens OX=9606 GN=CELF4 PE=1 SV=1
19	B4DHA8	0.003	43.5	454	0.028	0.048	B4DHA8_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens OX=9606 GN=CELF4 PE=1 SV=1
20	Q92879	0.003	43.5	486	0.028	0.045	CELF1_HUMAN CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	0.0007	30.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF15642 Tox-ODYAM1	8.7e+02	10.2	Toxin in Odyssella and Amoebophilus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264867

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000212015	0.999	NAD-dependent protein deacetylase sirtuin-1
2	9606.ENSP00000262238	0.999	Transcriptional repressor protein YY1
3	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
4	9606.ENSP00000384851	0.999	Steroid hormone receptor ERR1
5	9606.ENSP00000385523	0.999	Peroxisome proliferator-activated receptor alpha
6	9606.ENSP00000312987	0.998	Hepatocyte nuclear factor 4-alpha
7	9606.ENSP00000355904	0.998	Estrogen-related receptor gamma
8	9606.ENSP00000368880	0.997	Forkhead box protein O1
9	9606.ENSP00000376924	0.997	Nuclear respiratory factor 1
10	9606.ENSP00000383063	0.996	Nuclear receptor-interacting protein 1
11	9606.ENSP00000420588	0.994	Transcription factor A, mitochondrial
12	9606.ENSP00000405330	0.993	Estrogen receptor
13	9606.ENSP00000263253	0.992	Histone acetyltransferase p300
14	9606.ENSP00000385824	0.992	Forkhead box protein O3
15	9606.ENSP00000372191	0.991	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
16	9606.ENSP00000340874	0.990	Myocyte-specific enhancer factor 2C
17	9606.ENSP00000270722	0.988	PR domain zinc finger protein 16
18	9606.ENSP00000362824	0.988	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
19	9606.ENSP00000419692	0.987	Retinoic acid receptor RXR-alpha
20	9606.ENSP00000262367	0.984	CREB-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003676	0.999	nucleic acid binding
GO:0003723	0.960	RNA binding
GO:0016922	0.785	nuclear receptor binding
GO:0003677	0.448	DNA binding
GO:0003824	0.403	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0009893	0.995	positive regulation of metabolic process
GO:0062013	0.987	positive regulation of small molecule metabolic process
GO:0045944	0.987	positive regulation of transcription by RNA polymerase II
GO:0050896	0.986	response to stimulus
GO:0005996	0.985	monosaccharide metabolic process
GO:0009987	0.984	cellular process
GO:0042592	0.980	homeostatic process
GO:0006006	0.964	glucose metabolic process
GO:0006950	0.951	response to stress
GO:0044237	0.949	cellular metabolic process
GO:0032501	0.943	multicellular organismal process
GO:0048519	0.934	negative regulation of biological process
GO:1903578	0.933	regulation of ATP metabolic process
GO:0048523	0.862	negative regulation of cellular process
GO:0051716	0.799	cellular response to stimulus
GO:0006979	0.766	response to oxidative stress
GO:0032502	0.740	developmental process
GO:0045937	0.663	positive regulation of phosphate metabolic process
GO:0042221	0.639	response to chemical
GO:0051128	0.637	regulation of cellular component organization
GO:0048871	0.633	multicellular organismal-level homeostasis
GO:0065009	0.572	regulation of molecular function
GO:0048856	0.550	anatomical structure development
GO:0009058	0.548	biosynthetic process
GO:0006807	0.529	nitrogen compound metabolic process
GO:0010941	0.506	regulation of cell death
GO:0071840	0.503	cellular component organization or biogenesis
GO:1901576	0.497	organic substance biosynthetic process
GO:0070887	0.494	cellular response to chemical stimulus
GO:0051246	0.472	regulation of protein metabolic process
GO:0033043	0.465	regulation of organelle organization
GO:0043170	0.447	macromolecule metabolic process
GO:1901360	0.438	organic cyclic compound metabolic process
GO:0016043	0.437	cellular component organization
GO:0045981	0.437	positive regulation of nucleotide metabolic process
GO:0051239	0.419	regulation of multicellular organismal process
GO:0044093	0.414	positive regulation of molecular function
GO:0043067	0.408	regulation of programmed cell death
GO:0033554	0.402	cellular response to stress
GO:0048583	0.397	regulation of response to stimulus
GO:0006094	0.396	gluconeogenesis
GO:0009892	0.389	negative regulation of metabolic process
GO:0042127	0.382	regulation of cell population proliferation
GO:0042981	0.375	regulation of apoptotic process
GO:0031399	0.368	regulation of protein modification process
GO:0010821	0.351	regulation of mitochondrion organization
GO:0060548	0.348	negative regulation of cell death
GO:0050793	0.343	regulation of developmental process
GO:0031667	0.342	response to nutrient levels
GO:0065008	0.340	regulation of biological quality
GO:0051130	0.333	positive regulation of cellular component organization
GO:0006091	0.328	generation of precursor metabolites and energy
GO:1901564	0.315	organonitrogen compound metabolic process
GO:0010605	0.309	negative regulation of macromolecule metabolic process
GO:0019216	0.308	regulation of lipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.921	intracellular non-membrane-bounded organelle
GO:0005737	0.627	cytoplasm
GO:0000785	0.504	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]