StarFunc result for job id Q9UBK8

User Input

>input (698 residues)
MRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTT
GTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGA
RHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLV
KSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASL
NIPGLPPEYLQVHLQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDI
SNTDFSYQPGDAFSVICPNSDSEVQSLLQRLQLEDKREHCVLLKIKADTKKKGATLPQHI
PAGCSLQFIFTWCLEIRAIPKKAFLRALVDYTSDSAEKRRLQELCSKQGAADYSRFVRDA
CACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYSCASSSLFHPGKLHFVFNIVEFLSTAT
TEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPI
IMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHG
ILTHLKVSFSRDAPVGEEEAPAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDV
HDALVQIISKEVGVEKLEAMKTLATLKEEKRYLQDIWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C1A3	0.757	0.759	0.000	696	0.787	0.789	Q8C1A3.pdb.gz	MTRR_MOUSE Methionine synthase reductase OS=Mus musculus OX=10090 GN=Mtrr PE=1 SV=2
2	AFDB:Q9UBK8	1.000	1.000	0.000	698	1.000	1.000	Q9UBK8.pdb.gz	MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4
3	AFDB:Q384R3	0.614	0.671	6.676E-53	631	0.269	0.298	Q384R3.pdb.gz	Q384R3_TRYB2 NADPH--cytochrome p450 reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5420 PE=4 SV=1
4	AFDB:Q384I1	0.628	0.684	7.905E-53	635	0.282	0.310	Q384I1.pdb.gz	Q384I1_TRYB2 NADPH--cytochrome P450 reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0170 PE=4 SV=1
5	AFDB:Q7X7K8	0.626	0.628	2.178E-52	695	0.271	0.272	Q7X7K8.pdb.gz	NCPR1_ORYSJ NADPH--cytochrome P450 reductase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR1 PE=1 SV=2
6	AFDB:Q9SUM3	0.594	0.584	2.191E-51	711	0.272	0.267	Q9SUM3.pdb.gz	NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana OX=3702 GN=ATR2 PE=1 SV=1
7	AFDB:Q653S9	0.624	0.611	2.318E-51	714	0.275	0.269	Q653S9.pdb.gz	NCPR3_ORYSJ NADPH--cytochrome P450 reductase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR3 PE=1 SV=1
8	AFDB:P00388	0.618	0.634	2.452E-51	678	0.277	0.285	P00388.pdb.gz	NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus OX=10116 GN=Por PE=1 SV=3
9	AFDB:E1AVU6	0.626	0.644	2.594E-51	676	0.292	0.302	E1AVU6.pdb.gz	E1AVU6_CHICK NADPH--cytochrome P450 reductase OS=Gallus gallus OX=9031 GN=POR PE=2 SV=1
10	AFDB:A0A2U1LIM9	0.610	0.605	3.249E-51	704	0.272	0.270	A0A2U1LIM9.pdb.gz	NCPR1_ARTAN NADPH--cytochrome P450 reductase 1 OS=Artemisia annua OX=35608 GN=CPR1 PE=1 SV=2
11	PDB:6j79A	0.597	0.518	5.443E-51	816	0.269	0.230	6j79A.pdb.gz	Crystal structure of a NADPH-cytochrome P450 oxidoreductase (CYPOR) and heme oxygenase 1 fusion protein implies a conformational change in CYPOR upon NADPH/NADP+binding.
12	PDB:5gxuA	0.552	0.685	4.423E-48	552	0.256	0.324	5gxuA.pdb.gz	Structure of the Arabidopsis thaliana NADPH-cytochrome P450 reductase 2 (ATR2) provides insight into its function
13	PDB:2bf4A	0.604	0.648	4.096E-42	645	0.236	0.256	2bf4A.pdb.gz	A Second Fmn-Binding Site in Yeast Nadph-Cytochrome P450 Reductase Suggests a Mechanism of Electron Transfer by Diflavin Reductases.
14	PDB:7suzA	0.512	0.892	2.054E-35	389	0.189	0.339	7suzA.pdb.gz	Functional and structural insight into the flexibility of cytochrome P450 reductases from Sorghum bicolor and its implications for lignin composition.
15	PDB:3lvbA	0.352	0.756	1.052E-15	311	0.115	0.257	3lvbA.pdb.gz	Biochemical and crystallographic characterization of ferredoxin-NADP(+) reductase from nonphotosynthetic tissues
16	PDB:2m6sA	0.196	0.831	1.090E-9	149	0.069	0.322	2m6sA.pdb.gz	1H, 13C and 15N resonance assignments of the apo and holo states of flavodoxin YqcA from Escherichia coli.
17	PDB:4oxxA	0.183	0.750	1.373E-8	153	0.057	0.261	4oxxA.pdb.gz	Crystal structure of cindoxin, the P450cin redox partner.
18	PDB:1gvhA	0.256	0.432	4.768E-7	396	0.063	0.111	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
19	PDB:1fdrA	0.217	0.561	1.314E-6	244	0.056	0.160	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.
20	PDB:7romA	0.205	0.500	2.061E-6	255	0.062	0.169	7romA.pdb.gz	Crystal structure of Saccharomyces cerevisiae NADH-cytochrome b5 reductase 1 (Cbr1) fragment (residues 28-284) bound to FAD

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C1A3	0.0	1139	696	0.785	0.787	MTRR_MOUSE Methionine synthase reductase OS=Mus musculus OX=10090 GN=Mtrr PE=1 SV=2
2	Q9UBK8	0.0	1439	698	1.000	1.000	MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4
3	H0Y9D5	7.61e-92	284	160	0.196	0.856	H0Y9D5_HUMAN 5-methyltetrahydrofolate-homocysteine methyltransferase reductase (Fragment) OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=1
4	Q9SUM3	2.54e-73	253	711	0.275	0.270	NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana OX=3702 GN=ATR2 PE=1 SV=1
5	Q9SB48	4.18e-68	238	692	0.219	0.221	NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana OX=3702 GN=ATR1 PE=1 SV=1
6	Q653S9	5.68e-66	233	714	0.205	0.200	NCPR3_ORYSJ NADPH--cytochrome P450 reductase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR3 PE=1 SV=1
7	E1AVU6	5.96e-66	232	676	0.206	0.213	E1AVU6_CHICK NADPH--cytochrome P450 reductase OS=Gallus gallus OX=9031 GN=POR PE=2 SV=1
8	Q7X7K8	5.92e-64	227	695	0.211	0.212	NCPR1_ORYSJ NADPH--cytochrome P450 reductase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR1 PE=1 SV=2
9	P37040	8.72e-63	223	678	0.202	0.208	NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus OX=10090 GN=Por PE=1 SV=2
10	P00388	9.84e-63	223	678	0.203	0.209	NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus OX=10116 GN=Por PE=1 SV=3
11	Q0J705	9.99e-63	224	719	0.198	0.192	NCPR2_ORYSJ NADPH--cytochrome P450 reductase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR2 PE=1 SV=2
12	A0A2U1LIM9	1.05e-62	224	704	0.206	0.205	NCPR1_ARTAN NADPH--cytochrome P450 reductase 1 OS=Artemisia annua OX=35608 GN=CPR1 PE=1 SV=2
13	P16435	8.73e-62	221	677	0.202	0.208	NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2
14	Q27597	1.11e-61	220	679	0.205	0.211	NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster OX=7227 GN=Cpr PE=1 SV=2
15	C5YJG8	2.02e-61	220	706	0.199	0.197	NCPR_SORBI NADPH--cytochrome P450 reductase OS=Sorghum bicolor OX=4558 GN=CPR PE=1 SV=1
16	Q384I1	2.62e-59	213	635	0.226	0.249	Q384I1_TRYB2 NADPH--cytochrome P450 reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0170 PE=4 SV=1
17	A0A7T9QPQ1	4.29e-59	214	706	0.206	0.204	C719A_PIPNI Piperic acid synthase CYP719A37 OS=Piper nigrum OX=13216 GN=CYP719A37 PE=1 SV=1
18	Q384R3	2.12e-57	207	631	0.201	0.222	Q384R3_TRYB2 NADPH--cytochrome p450 reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5420 PE=4 SV=1
19	Q7Z270	2.74e-57	207	635	0.225	0.247	Q7Z270_TRYBB p450 reductase OS=Trypanosoma brucei brucei OX=5702 PE=4 SV=1
20	P29473	1.40e-56	211	1205	0.284	0.164	NOS3_BOVIN Nitric oxide synthase 3 OS=Bos taurus OX=9913 GN=NOS3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00667 FAD_binding_1	1.6e-48	176.7	FAD binding domain
2	PF00258 Flavodoxin_1	1.5e-28	111.2	Flavodoxin
3	PF12641 Flavodoxin_3	2.9e+02	12.6	Flavodoxin domain
4	PF12724 Flavodoxin_5	0.53	22.0	Flavodoxin domain
5	PF00175 NAD_binding_1	8e-14	63.6	Oxidoreductase NAD-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264668

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355536	0.992	Methionine synthase
2	9606.ENSP00000365777	0.960	Methylenetetrahydrofolate reductase
3	9606.ENSP00000389060	0.960	Methylmalonic aciduria and homocystinuria type D protein, mitochondrial
4	9606.ENSP00000383840	0.948	Methylmalonic aciduria and homocystinuria type C protein
5	9606.ENSP00000445920	0.917	Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
6	9606.ENSP00000216605	0.866	C-1-tetrahydrofolate synthase, cytoplasmic
7	9606.ENSP00000281317	0.858	Methylmalonic aciduria type A protein, mitochondrial
8	9606.ENSP00000385746	0.848	Spermine synthase
9	9606.ENSP00000215838	0.817	Transcobalamin-2
10	9606.ENSP00000318868	0.814	Serine hydroxymethyltransferase, cytosolic
11	9606.ENSP00000274353	0.797	Betaine--homocysteine S-methyltransferase 1
12	9606.ENSP00000381231	0.792	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
13	9606.ENSP00000381234	0.792	annotation not available
14	9606.ENSP00000274813	0.770	Methylmalonyl-CoA mutase, mitochondrial
15	9606.ENSP00000359609	0.769	Probable lysosomal cobalamin transporter
16	9606.ENSP00000308895	0.762	Folate transporter 1
17	9606.ENSP00000255189	0.760	Dimethylglycine dehydrogenase, mitochondrial
18	9606.ENSP00000315644	0.756	Thymidylate synthase
19	9606.ENSP00000332886	0.732	FRAS1-related extracellular matrix protein 3
20	9606.ENSP00000255192	0.719	S-methylmethionine--homocysteine S-methyltransferase BHMT2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016722	0.999	oxidoreductase activity, acting on metal ions
GO:0005515	0.998	protein binding
GO:1901265	0.998	nucleoside phosphate binding
GO:0003958	0.995	NADPH-hemoprotein reductase activity
GO:0036094	0.988	small molecule binding
GO:0043168	0.985	anion binding
GO:0000166	0.983	nucleotide binding
GO:0032553	0.956	ribonucleotide binding
GO:0010181	0.949	FMN binding
GO:0050661	0.942	NADP binding
GO:0050660	0.936	flavin adenine dinucleotide binding
GO:0070402	0.849	NADPH binding
GO:0071949	0.784	FAD binding
GO:0016723	0.368	oxidoreductase activity, acting on metal ions, NAD or NADP as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006790	0.994	sulfur compound metabolic process
GO:1901360	0.990	organic cyclic compound metabolic process
GO:0046483	0.989	heterocycle metabolic process
GO:0044238	0.988	primary metabolic process
GO:0043436	0.986	oxoacid metabolic process
GO:0006575	0.975	cellular modified amino acid metabolic process
GO:0006766	0.954	vitamin metabolic process
GO:0000096	0.946	sulfur amino acid metabolic process
GO:0006767	0.943	water-soluble vitamin metabolic process
GO:1901605	0.921	alpha-amino acid metabolic process
GO:0044249	0.915	cellular biosynthetic process
GO:0042558	0.910	pteridine-containing compound metabolic process
GO:1901566	0.899	organonitrogen compound biosynthetic process
GO:0044272	0.890	sulfur compound biosynthetic process
GO:0006760	0.885	folic acid-containing compound metabolic process
GO:0006555	0.828	methionine metabolic process
GO:0043648	0.823	dicarboxylic acid metabolic process
GO:0000097	0.749	sulfur amino acid biosynthetic process
GO:0009086	0.737	methionine biosynthetic process
GO:0065007	0.618	biological regulation
GO:0043603	0.328	amide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0005829	0.993	cytosol
GO:0005634	0.992	nucleus
GO:0031981	0.977	nuclear lumen
GO:0005654	0.973	nucleoplasm
GO:0043232	0.911	intracellular non-membrane-bounded organelle
GO:0005856	0.887	cytoskeleton
GO:0045111	0.743	intermediate filament cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.16.-.-	0.999	Oxidizing metal ions.
RHEA:24040	0.995	NADPH + 2 oxidized [cytochrome P450] = H(+) + NADP(+) + 2 reduced [cytochrome P450]
EC:1.6.2.4	0.995	NADPH--hemoprotein reductase.
EC:1.16.1.-	0.368	With NAD(+) or NADP(+) as acceptor.

[back to server]