StarFunc result for job id Q9UBL3

User Input

>input (628 residues)
MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGY
GQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSE
IIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWG
AVVEHTLADVLYHVETEVDGRRSPPWEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBL3	1.000	1.000	0.000	628	1.000	1.000	Q9UBL3.pdb.gz	ASH2L_HUMAN Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1
2	AFDB:F1RAW8	0.716	0.754	3.483E-104	590	0.758	0.807	F1RAW8.pdb.gz	F1RAW8_DANRE Ash2-like, histone lysine methyltransferase complex subunit OS=Danio rerio OX=7955 GN=fb34c06 PE=1 SV=1
3	PDB:6venO	0.343	0.662	2.245E-17	315	0.094	0.187	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
4	PDB:7nscA	0.238	0.524	1.506E-11	276	0.075	0.170	7nscA.pdb.gz
5	PDB:7ccbA	0.235	0.848	2.659E-11	164	0.057	0.220	7ccbA.pdb.gz
6	PDB:7tzcA	0.188	0.027	3.846E-10	4404	0.061	0.009	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
7	PDB:7ua3A	0.192	0.028	4.310E-10	4443	0.062	0.009	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
8	PDB:6wotA	0.210	0.033	1.422E-9	4197	0.064	0.010	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
9	PDB:7m6aA	0.190	0.028	1.889E-9	4306	0.062	0.009	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
10	PDB:7u9tA	0.205	0.031	2.977E-9	4229	0.065	0.010	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
11	PDB:3j8hA	0.188	0.033	3.336E-9	3660	0.064	0.011	3j8hA.pdb.gz	Structure of the rabbit ryanodine receptor RyR1 at near-atomic resolution.
12	PDB:5t15B	0.194	0.032	5.564E-9	4170	0.062	0.009	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
13	AFDB:P38800	0.075	0.043	1.022E-2	1345	0.116	0.054	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
14	AFDB:Q9VTR6	0.078	0.034	8.862E-2	1713	0.129	0.047	Q9VTR6.pdb.gz	Q9VTR6_DROME Pericardin OS=Drosophila melanogaster OX=7227 GN=prc PE=1 SV=2
15	AFDB:P39061	0.129	0.058	1.397E-1	1774	0.146	0.052	P39061.pdb.gz	COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4
16	AFDB:Q99NE5	0.063	0.039	1.565E-1	1463	0.115	0.049	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
17	AFDB:Q6IMN6	0.073	0.049	2.079E-1	1127	0.102	0.057	Q6IMN6.pdb.gz	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
18	AFDB:Q05A80	0.074	0.055	2.610E-1	1031	0.102	0.062	Q05A80.pdb.gz	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
19	AFDB:Q8INL2	0.089	0.062	4.113E-1	960	0.080	0.052	Q8INL2.pdb.gz	Q8INL2_DROME Chromosome associated protein H2, isoform E OS=Drosophila melanogaster OX=7227 GN=Cap-H2 PE=4 SV=2
20	AFDB:Q24459	0.197	0.121	5.785E-1	1043	0.110	0.066	Q24459.pdb.gz	PCL_DROME Polycomb protein Pcl OS=Drosophila melanogaster OX=7227 GN=Pcl PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RAW8	0.0	1025	590	0.755	0.803	F1RAW8_DANRE Ash2-like, histone lysine methyltransferase complex subunit OS=Danio rerio OX=7955 GN=fb34c06 PE=1 SV=1
2	Q91X20	0.0	1241	623	0.959	0.966	ASH2L_MOUSE Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Mus musculus OX=10090 GN=Ash2l PE=1 SV=1
3	Q9UBL3	0.0	1307	628	1.000	1.000	ASH2L_HUMAN Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1
4	Q94545	2.32e-166	488	556	0.417	0.471	ASH2_DROME Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Drosophila melanogaster OX=7227 GN=ash2 PE=1 SV=2
5	G5EFZ3	2.52e-91	295	570	0.311	0.342	ASH2_CAEEL Set1/Ash2 histone methyltransferase complex subunit ash-2 OS=Caenorhabditis elegans OX=6239 GN=ash-2 PE=1 SV=1
6	A0A168H287	7.06e-91	294	575	0.307	0.336	A0A168H287_CAEEL B30.2/SPRY domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ash-2 PE=1 SV=1
7	Q9XXH4	1.52e-90	293	572	0.309	0.339	Q9XXH4_CAEEL B30.2/SPRY domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ash-2 PE=1 SV=1
8	Q9C8J7	1.20e-44	168	509	0.151	0.187	TRO_ARATH Protein TRAUCO OS=Arabidopsis thaliana OX=3702 GN=TRO PE=1 SV=1
9	O60070	4.84e-41	160	652	0.237	0.229	ASH2_SCHPO Set1 complex component ash2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ash2 PE=3 SV=1
10	Q55AQ4	6.64e-26	115	988	0.105	0.067	Q55AQ4_DICDI B30.2/SPRY domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271754 PE=4 SV=1
11	Q5AQN1	5.01e-08	58.5	607	0.119	0.124	CCLA_EMENI COMPASS component cclA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cclA PE=3 SV=1
12	Q2U741	5.28e-08	58.5	617	0.116	0.118	CCLA_ASPOR COMPASS component cclA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=cclA PE=3 SV=1
13	Q4WEY5	6.67e-08	58.2	618	0.129	0.131	CCLA_ASPFU COMPASS component cclA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=cclA PE=3 SV=1
14	Q24498	1.93e-05	50.4	5127	0.051	0.006	RYR_DROME Ryanodine receptor OS=Drosophila melanogaster OX=7227 GN=RyR PE=1 SV=3
15	Q15413	2.85e-05	50.1	4870	0.049	0.006	RYR3_HUMAN Ryanodine receptor 3 OS=Homo sapiens OX=9606 GN=RYR3 PE=1 SV=3
16	P30957	7.50e-05	48.5	4969	0.048	0.006	RYR2_RABIT Ryanodine receptor 2 OS=Oryctolagus cuniculus OX=9986 GN=RYR2 PE=1 SV=3
17	B0LPN4	8.66e-05	48.5	4953	0.049	0.006	RYR2_RAT Ryanodine receptor 2 OS=Rattus norvegicus OX=10116 GN=Ryr2 PE=1 SV=2
18	Q92736	8.88e-05	48.5	4967	0.049	0.006	RYR2_HUMAN Ryanodine receptor 2 OS=Homo sapiens OX=9606 GN=RYR2 PE=1 SV=3
19	A2AGL3	1.25e-04	47.8	4863	0.048	0.006	RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus OX=10090 GN=Ryr3 PE=1 SV=1
20	Q9VFC4	1.33e-04	47.8	1332	0.088	0.041	Q9VFC4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Kpc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00622 SPRY	1.4e-09	49.5	SPRY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340896

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262189	0.999	Histone-lysine N-methyltransferase 2C
2	9606.ENSP00000262519	0.999	Histone-lysine N-methyltransferase SETD1A
3	9606.ENSP00000264515	0.999	Retinoblastoma-binding protein 5
4	9606.ENSP00000296490	0.999	WD repeat-containing protein 82
5	9606.ENSP00000301067	0.999	Histone-lysine N-methyltransferase 2D
6	9606.ENSP00000345837	0.999	Protein dpy-30 homolog
7	9606.ENSP00000351446	0.999	WD repeat-containing protein 5
8	9606.ENSP00000398837	0.999	Histone-lysine N-methyltransferase 2B
9	9606.ENSP00000436786	0.999	Histone-lysine N-methyltransferase 2A
10	9606.ENSP00000442924	0.999	Histone-lysine N-methyltransferase SETD1B
11	9606.ENSP00000367203	0.998	Lysine-specific demethylase 6A
12	9606.ENSP00000384048	0.998	PAX-interacting protein 1
13	9606.ENSP00000390475	0.998	CXXC-type zinc finger protein 1
14	9606.ENSP00000309555	0.995	Host cell factor 1
15	9606.ENSP00000363929	0.994	Nuclear receptor coactivator 6
16	9606.ENSP00000337088	0.991	Menin
17	9606.ENSP00000326519	0.979	PAXIP1 associated glutamate rich protein 1
18	9606.ENSP00000271555	0.974	Myocyte-specific enhancer factor 2D
19	9606.ENSP00000476774	0.972	PAXIP1-associated glutamate-rich protein 1
20	9606.ENSP00000355657	0.971	Histone H3.1t

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008013	1.000	beta-catenin binding
GO:0018024	0.999	histone lysine N-methyltransferase activity
GO:0140938	0.998	histone H3 methyltransferase activity
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0042800	0.992	histone H3K4 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0010468	0.988	regulation of gene expression
GO:0009893	0.985	positive regulation of metabolic process
GO:0010604	0.984	positive regulation of macromolecule metabolic process
GO:0009987	0.983	cellular process
GO:0048522	0.980	positive regulation of cellular process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0019219	0.964	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.929	regulation of biosynthetic process
GO:0051252	0.851	regulation of RNA metabolic process
GO:0010556	0.843	regulation of macromolecule biosynthetic process
GO:0031326	0.841	regulation of cellular biosynthetic process
GO:0051173	0.838	positive regulation of nitrogen compound metabolic process
GO:0006355	0.821	regulation of DNA-templated transcription
GO:0031325	0.793	positive regulation of cellular metabolic process
GO:0045935	0.766	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.746	regulation of transcription by RNA polymerase II
GO:0045893	0.745	positive regulation of DNA-templated transcription
GO:0050896	0.554	response to stimulus
GO:0071840	0.530	cellular component organization or biogenesis
GO:0016043	0.490	cellular component organization
GO:0045944	0.461	positive regulation of transcription by RNA polymerase II
GO:0071704	0.365	organic substance metabolic process
GO:0051716	0.361	cellular response to stimulus
GO:0006338	0.343	chromatin remodeling
GO:0044238	0.330	primary metabolic process
GO:0006807	0.319	nitrogen compound metabolic process
GO:0043170	0.304	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035097	0.998	histone methyltransferase complex
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0044665	0.987	MLL1/2 complex
GO:0000785	0.956	chromatin
GO:0071339	0.938	MLL1 complex
GO:0005737	0.727	cytoplasm
GO:0044666	0.414	MLL3/4 complex
GO:0048188	0.391	Set1C/COMPASS complex
GO:0005829	0.357	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	0.999	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine
RHEA:60260	0.992	L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine
EC:2.1.1.354	0.992	[histone H3]-lysine(4) N-trimethyltransferase.

[back to server]