StarFunc result for job id Q9UBM4

User Input

>input (332 residues)
MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVI
DLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQ
PNHGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLK
RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQP
AAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQ
LEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBM4	1.000	1.000	1.270E-51	332	1.000	1.000	Q9UBM4.pdb.gz	OPT_HUMAN Opticin OS=Homo sapiens OX=9606 GN=OPTC PE=1 SV=1
2	AFDB:Q920A0	0.637	0.644	1.431E-38	328	0.729	0.738	Q920A0.pdb.gz	OPT_MOUSE Opticin OS=Mus musculus OX=10090 GN=Optc PE=1 SV=2
3	AFDB:A8BBE6	0.652	0.673	2.183E-25	321	0.416	0.430	A8BBE6.pdb.gz
4	AFDB:P70186	0.617	0.636	2.672E-25	322	0.404	0.416	P70186.pdb.gz	EPYC_MOUSE Epiphycan OS=Mus musculus OX=10090 GN=Epyc PE=2 SV=1
5	AFDB:A8BBB9	0.609	0.647	1.045E-24	312	0.392	0.417	A8BBB9.pdb.gz
6	AFDB:B4DI63	0.615	0.575	3.174E-24	356	0.361	0.337	B4DI63.pdb.gz	B4DI63_HUMAN cDNA FLJ59205, highly similar to Mimecan OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:D3ZVB7	0.669	0.742	2.785E-23	298	0.343	0.383	D3ZVB7.pdb.gz	D3ZVB7_RAT Osteoglycin OS=Rattus norvegicus OX=10116 GN=Ogn PE=1 SV=1
8	AFDB:Q5RI45	0.407	0.367	7.473E-12	373	0.214	0.190	Q5RI45.pdb.gz
9	AFDB:P51888	0.456	0.402	3.074E-11	382	0.214	0.186	P51888.pdb.gz	PRELP_HUMAN Prolargin OS=Homo sapiens OX=9606 GN=PRELP PE=1 SV=1
10	AFDB:P21809	0.494	0.450	3.233E-11	369	0.232	0.209	P21809.pdb.gz	PGS1_BOVIN Biglycan OS=Bos taurus OX=9913 GN=BGN PE=1 SV=3
11	PDB:1xcdA	0.417	0.449	6.590E-10	305	0.208	0.226	1xcdA.pdb.gz
12	PDB:2ft3F	0.396	0.426	1.149E-9	305	0.184	0.200	2ft3F.pdb.gz
13	PDB:5yq5B	0.374	0.402	2.450E-9	306	0.241	0.261	5yq5B.pdb.gz
14	PDB:3b2dA	0.391	0.233	1.453E-5	601	0.160	0.088	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:7tvfD	0.350	0.242	1.778E-5	515	0.151	0.097	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
16	PDB:6gffI	0.380	0.249	3.429E-5	551	0.172	0.103	6gffI.pdb.gz
17	PDB:3t6qA	0.421	0.247	6.954E-5	601	0.148	0.082	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:7wv3A	0.477	0.247	7.693E-5	668	0.148	0.073	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
19	PDB:7p5vB	0.329	0.161	1.275E-4	732	0.127	0.057	7p5vB.pdb.gz
20	PDB:6hkwA	0.388	0.418	2.337E-4	306	0.130	0.141	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBM4	0.0	667	332	1.000	1.000	OPT_HUMAN Opticin OS=Homo sapiens OX=9606 GN=OPTC PE=1 SV=1
2	Q920A0	4.63e-161	454	328	0.696	0.704	OPT_MOUSE Opticin OS=Mus musculus OX=10090 GN=Optc PE=1 SV=2
3	P70186	1.18e-80	250	322	0.361	0.373	EPYC_MOUSE Epiphycan OS=Mus musculus OX=10090 GN=Epyc PE=2 SV=1
4	Q99645	1.23e-78	244	322	0.352	0.363	EPYC_HUMAN Epiphycan OS=Homo sapiens OX=9606 GN=EPYC PE=2 SV=3
5	D3ZVB7	5.06e-69	219	298	0.328	0.366	D3ZVB7_RAT Osteoglycin OS=Rattus norvegicus OX=10116 GN=Ogn PE=1 SV=1
6	Q62000	1.75e-68	218	298	0.295	0.329	MIME_MOUSE Mimecan OS=Mus musculus OX=10090 GN=Ogn PE=1 SV=1
7	P20774	4.02e-63	204	298	0.292	0.326	MIME_HUMAN Mimecan OS=Homo sapiens OX=9606 GN=OGN PE=1 SV=1
8	B4DI63	2.21e-62	204	356	0.292	0.272	B4DI63_HUMAN cDNA FLJ59205, highly similar to Mimecan OS=Homo sapiens OX=9606 PE=2 SV=1
9	P21793	2.62e-18	86.7	360	0.196	0.181	PGS2_BOVIN Decorin OS=Bos taurus OX=9913 GN=DCN PE=1 SV=2
10	Q9XSD9	1.06e-17	85.1	360	0.193	0.178	PGS2_PIG Decorin OS=Sus scrofa OX=9823 GN=DCN PE=2 SV=1
11	B5X3L8	3.40e-17	83.6	364	0.175	0.159	B5X3L8_SALSA Decorin OS=Salmo salar OX=8030 GN=PGS2 PE=2 SV=1
12	Q99983	3.53e-17	84.0	421	0.226	0.178	OMD_HUMAN Osteomodulin OS=Homo sapiens OX=9606 GN=OMD PE=1 SV=1
13	P07585	4.60e-17	83.2	359	0.184	0.170	PGS2_HUMAN Decorin OS=Homo sapiens OX=9606 GN=DCN PE=1 SV=1
14	P51884	1.48e-16	81.3	338	0.199	0.195	LUM_HUMAN Lumican OS=Homo sapiens OX=9606 GN=LUM PE=1 SV=2
15	O35103	1.68e-16	82.0	423	0.211	0.165	OMD_MOUSE Osteomodulin OS=Mus musculus OX=10090 GN=Omd PE=2 SV=1
16	F1S6B4	1.96e-16	81.6	381	0.166	0.144	F1S6B4_PIG Prolargin OS=Sus scrofa OX=9823 GN=PRELP PE=1 SV=3
17	Q8BZ81	2.79e-16	81.6	582	0.211	0.120	LRRT3_MOUSE Leucine-rich repeat transmembrane neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrtm3 PE=2 SV=2
18	Q86VH5	3.54e-16	81.6	581	0.211	0.120	LRRT3_HUMAN Leucine-rich repeat transmembrane neuronal protein 3 OS=Homo sapiens OX=9606 GN=LRRTM3 PE=2 SV=2
19	P51888	6.01e-16	80.1	382	0.169	0.147	PRELP_HUMAN Prolargin OS=Homo sapiens OX=9606 GN=PRELP PE=1 SV=1
20	Q9EQP5	9.88e-16	79.3	377	0.190	0.167	PRELP_RAT Prolargin OS=Rattus norvegicus OX=10116 GN=Prelp PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01462 LRRNT	3.1e+02	12.4	Leucine rich repeat N-terminal domain
2	PF00560 LRR_1	1.6e+02	14.2	Leucine Rich Repeat
3	PF12799 LRR_4	4.8e-06	38.1	Leucine Rich repeats (2 copies)
4	PF13306 LRR_5	0.55	21.6	BspA type Leucine rich repeat region (6 copies)
5	PF13516 LRR_6	66	15.0	Leucine Rich repeat
6	PF13855 LRR_8	1.1e-17	74.8	Leucine rich repeat
7	PF14580 LRR_9	3e+02	12.4	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356191

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260302	0.911	Collagenase 3
2	9606.ENSP00000219070	0.904	72 kDa type IV collagenase
3	9606.ENSP00000260227	0.904	Matrilysin
4	9606.ENSP00000295666	0.789	Insulin-like growth factor-binding protein 7
5	9606.ENSP00000340328	0.755	Nyctalopin
6	9606.ENSP00000344871	0.700	Unconventional myosin-If
7	9606.ENSP00000239891	0.697	ALG5, dolichyl-phosphate beta-glucosyltransferase
8	9606.ENSP00000288139	0.669	Voltage-dependent L-type calcium channel subunit alpha-1D
9	9606.ENSP00000351524	0.666	Probable helicase with zinc finger domain
10	9606.ENSP00000288235	0.578	Unconventional myosin-Ie
11	9606.ENSP00000346839	0.559	Fibronectin type III domain containing
12	9606.ENSP00000365441	0.551	Voltage-dependent L-type calcium channel subunit alpha-1F
13	9606.ENSP00000314343	0.550	Mediator of RNA polymerase II transcription subunit 29
14	9606.ENSP00000423067	0.516	WD repeat-containing protein 36
15	9606.ENSP00000323065	0.506	Growth arrest and DNA damage-inducible proteins-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005201	1.000	extracellular matrix structural constituent
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0032501	0.986	multicellular organismal process
GO:0065007	0.977	biological regulation
GO:0007275	0.977	multicellular organism development
GO:0050789	0.972	regulation of biological process
GO:0071840	0.833	cellular component organization or biogenesis
GO:0016043	0.824	cellular component organization
GO:0043062	0.813	extracellular structure organization
GO:0045229	0.778	external encapsulating structure organization
GO:0048731	0.767	system development
GO:0030198	0.753	extracellular matrix organization
GO:0048519	0.627	negative regulation of biological process
GO:0009653	0.620	anatomical structure morphogenesis
GO:0050794	0.513	regulation of cellular process
GO:0050896	0.392	response to stimulus
GO:0051239	0.380	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	1.000	extracellular matrix
GO:0005576	0.998	extracellular region
GO:0005615	0.868	extracellular space
GO:0062023	0.609	collagen-containing extracellular matrix
GO:0016020	0.518	membrane
GO:0043226	0.361	organelle
GO:0005886	0.338	plasma membrane
GO:0005622	0.330	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]