StarFunc result for job id Q9UBN1

User Input

>input (327 residues)
MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGD
LTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLL
GGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYN
YGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRR
RRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQEASF
LQVHDFFQQDLKEGFHVSMLNRRTTPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VHW9	0.804	0.804	4.612E-48	327	0.982	0.982	Q8VHW9.pdb.gz	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
2	AFDB:Q8WXS5	0.636	0.491	1.254E-31	425	0.590	0.454	Q8WXS5.pdb.gz	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
3	AFDB:O88602	0.641	0.649	3.806E-31	323	0.599	0.607	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
4	AFDB:O60359	0.638	0.662	1.504E-30	315	0.541	0.562	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
5	AFDB:Q6PFS3	0.643	0.649	1.585E-30	324	0.587	0.593	Q6PFS3.pdb.gz	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
6	PDB:7ocaI	0.536	0.937	4.723E-20	185	0.391	0.692	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
7	PDB:5weoA	0.524	0.180	5.623E-17	988	0.394	0.131	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
8	PDB:5kbtA	0.474	0.174	7.108E-16	973	0.404	0.136	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
9	AFDB:Q8VHW8	0.504	0.595	3.069E-15	275	0.226	0.269	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
10	AFDB:P62955	0.523	0.614	2.680E-14	275	0.239	0.284	P62955.pdb.gz	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
11	PDB:7rz4A	0.476	0.166	2.310E-12	993	0.190	0.062	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
12	AFDB:G5EDT2	0.553	0.501	1.444E-11	366	0.183	0.164	G5EDT2.pdb.gz	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1
13	AFDB:Q8R1W2	0.493	0.497	6.016E-11	324	0.168	0.170	Q8R1W2.pdb.gz	GSG1_MOUSE Germ cell-specific gene 1 protein OS=Mus musculus OX=10090 GN=Gsg1 PE=1 SV=2
14	AFDB:Q2KHT4	0.500	0.471	2.029E-10	349	0.183	0.172	Q2KHT4.pdb.gz	GSG1_HUMAN Germ cell-specific gene 1 protein OS=Homo sapiens OX=9606 GN=GSG1 PE=1 SV=2
15	PDB:5kk2E	0.415	0.706	5.467E-9	173	0.355	0.671	5kk2E.pdb.gz
16	PDB:7rzaA	0.466	0.164	6.034E-7	981	0.135	0.045	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
17	PDB:5b2gC	0.394	0.370	5.855E-6	350	0.104	0.097	5b2gC.pdb.gz
18	PDB:6jp5E	0.397	0.730	5.855E-6	169	0.113	0.219	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
19	PDB:6ov2A	0.395	0.676	2.859E-5	182	0.104	0.187	6ov2A.pdb.gz
20	PDB:6c14B	0.389	0.718	6.130E-4	164	0.107	0.213	6c14B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VHW9	0.0	668	327	0.982	0.982	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
2	Q9JJV4	0.0	668	327	0.982	0.982	CCG4_MOUSE Voltage-dependent calcium channel gamma-4 subunit OS=Mus musculus OX=10090 GN=Cacng4 PE=1 SV=1
3	Q9UBN1	0.0	678	327	1.000	1.000	CCG4_HUMAN Voltage-dependent calcium channel gamma-4 subunit OS=Homo sapiens OX=9606 GN=CACNG4 PE=1 SV=1
4	O88602	5.36e-124	360	323	0.581	0.588	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
5	Q71RJ2	5.36e-124	360	323	0.581	0.588	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
6	Q9Y698	4.86e-123	357	323	0.578	0.585	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
7	Q8VHW5	1.69e-117	347	421	0.563	0.437	CCG8_RAT Voltage-dependent calcium channel gamma-8 subunit OS=Rattus norvegicus OX=10116 GN=Cacng8 PE=1 SV=1
8	O60359	3.52e-117	342	315	0.547	0.568	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
9	Q8VHW2	7.19e-117	345	423	0.560	0.433	CCG8_MOUSE Voltage-dependent calcium channel gamma-8 subunit OS=Mus musculus OX=10090 GN=Cacng8 PE=1 SV=1
10	Q6PFS3	2.86e-116	340	324	0.581	0.586	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
11	Q8VHX0	1.39e-114	336	315	0.538	0.559	CCG3_RAT Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1
12	Q9JJV5	1.39e-114	336	315	0.538	0.559	CCG3_MOUSE Voltage-dependent calcium channel gamma-3 subunit OS=Mus musculus OX=10090 GN=Cacng3 PE=1 SV=2
13	Q8WXS5	1.78e-111	332	425	0.471	0.362	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
14	Q8VHW8	9.06e-35	129	275	0.211	0.251	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
15	Q9UF02	3.33e-34	128	275	0.208	0.247	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
16	P62955	2.13e-30	118	275	0.220	0.262	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
17	P62956	2.13e-30	118	275	0.220	0.262	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
18	P62957	2.13e-30	118	275	0.220	0.262	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
19	Q9VRE6	1.52e-10	63.9	447	0.202	0.148	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
20	Q9D563	3.01e-08	55.8	222	0.171	0.252	TM114_MOUSE Transmembrane protein 114 OS=Mus musculus OX=10090 GN=Tmem114 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13520 AA_permease_2	4.2	17.8	Amino acid permease
2	PF13903 Claudin_2	8.3e-16	69.8	PMP-22/EMP/MP20/Claudin tight junction
3	PF10027 DUF2269	3.8e+02	12.5	Predicted integral membrane protein (DUF2269)
4	PF00822 PMP22_Claudin	1.3e-36	137.4	PMP-22/EMP/MP20/Claudin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262138

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288139	0.959	Voltage-dependent L-type calcium channel subunit alpha-1D
2	9606.ENSP00000282499	0.958	Glutamate receptor 4
3	9606.ENSP00000349320	0.957	Voltage-dependent calcium channel subunit alpha-2/delta-1
4	9606.ENSP00000252729	0.953	Voltage-dependent calcium channel gamma-6 subunit
5	9606.ENSP00000481554	0.953	Glutamate receptor 3
6	9606.ENSP00000428994	0.948	Glutamate receptor 1
7	9606.ENSP00000226021	0.947	Voltage-dependent calcium channel gamma-1 subunit
8	9606.ENSP00000438949	0.941	Voltage-dependent L-type calcium channel subunit beta-4
9	9606.ENSP00000301050	0.936	Voltage-dependent L-type calcium channel subunit beta-3
10	9606.ENSP00000339740	0.936	Calcium/calmodulin-dependent protein kinase type II subunit delta
11	9606.ENSP00000372169	0.936	Voltage-dependent calcium channel subunit alpha-2/delta-4
12	9606.ENSP00000266376	0.934	Voltage-dependent L-type calcium channel subunit alpha-1C
13	9606.ENSP00000365441	0.928	Voltage-dependent L-type calcium channel subunit alpha-1F
14	9606.ENSP00000375647	0.927	Voltage-dependent calcium channel gamma-7 subunit
15	9606.ENSP00000379098	0.921	Calcium/calmodulin-dependent protein kinase type II subunit beta
16	9606.ENSP00000319060	0.912	Calcium/calmodulin-dependent protein kinase type II subunit gamma
17	9606.ENSP00000355192	0.912	Voltage-dependent L-type calcium channel subunit alpha-1S
18	9606.ENSP00000358994	0.910	Unconventional myosin-VI
19	9606.ENSP00000378207	0.910	A-kinase anchor protein 5
20	9606.ENSP00000381412	0.909	Calcium/calmodulin-dependent protein kinase type II subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099106	0.996	ion channel regulator activity
GO:0035255	0.995	ionotropic glutamate receptor binding
GO:0005246	0.989	calcium channel regulator activity
GO:0022857	0.901	transmembrane transporter activity
GO:0005216	0.646	monoatomic ion channel activity
GO:0022839	0.608	monoatomic ion gated channel activity
GO:0005261	0.602	monoatomic cation channel activity
GO:0015318	0.551	inorganic molecular entity transmembrane transporter activity
GO:0022890	0.540	inorganic cation transmembrane transporter activity
GO:0046873	0.493	metal ion transmembrane transporter activity
GO:1901702	0.442	salt transmembrane transporter activity
GO:0005244	0.433	voltage-gated monoatomic ion channel activity
GO:0015085	0.364	calcium ion transmembrane transporter activity
GO:0005262	0.333	calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0065009	0.975	regulation of molecular function
GO:0048583	0.975	regulation of response to stimulus
GO:0032409	0.961	regulation of transporter activity
GO:0010469	0.955	regulation of signaling receptor activity
GO:0099601	0.954	regulation of neurotransmitter receptor activity
GO:0032412	0.952	regulation of monoatomic ion transmembrane transporter activity
GO:0009987	0.807	cellular process
GO:0050896	0.727	response to stimulus
GO:0007154	0.471	cell communication
GO:0032501	0.371	multicellular organismal process
GO:0048518	0.339	positive regulation of biological process
GO:0051179	0.315	localization
GO:0043269	0.302	regulation of monoatomic ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0098797	1.000	plasma membrane protein complex
GO:0034702	1.000	ion channel complex
GO:0030054	0.995	cell junction
GO:0005737	0.995	cytoplasm
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0045202	0.970	synapse
GO:0098878	0.960	neurotransmitter receptor complex
GO:0032281	0.954	AMPA glutamate receptor complex
GO:0098978	0.933	glutamatergic synapse
GO:0031982	0.907	vesicle
GO:0045211	0.895	postsynaptic membrane
GO:0099634	0.865	postsynaptic specialization membrane
GO:0098984	0.851	neuron to neuron synapse
GO:0031090	0.847	organelle membrane
GO:0032279	0.842	asymmetric synapse
GO:0014069	0.829	postsynaptic density
GO:0098839	0.824	postsynaptic density membrane
GO:0034703	0.798	cation channel complex
GO:0031410	0.747	cytoplasmic vesicle
GO:0034704	0.708	calcium channel complex
GO:0036477	0.624	somatodendritic compartment
GO:0098588	0.412	bounding membrane of organelle
GO:0012505	0.401	endomembrane system
GO:0030659	0.390	cytoplasmic vesicle membrane
GO:0005891	0.371	voltage-gated calcium channel complex
GO:0030139	0.354	endocytic vesicle
GO:0030666	0.340	endocytic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.364	Ca(2+)(in) = Ca(2+)(out)

[back to server]