StarFunc result for job id Q9UBN4

User Input

>input (977 residues)
MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFK
ININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKK
PSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVE
CVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSE
YEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIR
KPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEAL
FAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFY
YEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATM
FGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVI
PSPKSLWYLIKWIWTHLCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAA
MIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLSTIQSANASKESSNSADSDEK
SDSEGNSKDKKKNFSLFDLTTLIHPRSAAIASERHNISNGSALVVQEPPREKQRKVNFVT
DIKNFGLFHRRSKQNAAEQNANQIFSVSEEVARQQAAGPLERNIQLESRGLASRGDLSIP
GLSEQCVLVDHRERNTDTLGLQVGKRVCPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYD
LNLPDTVTHEDYVTTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35119	0.850	0.850	0.000	977	0.970	0.970	O35119.pdb.gz	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
2	AFDB:A0A0R4IM91	0.795	0.848	3.191E-87	915	0.714	0.763	A0A0R4IM91.pdb.gz	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
3	AFDB:Q9QX29	0.760	0.761	6.116E-82	975	0.655	0.656	Q9QX29.pdb.gz	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
4	PDB:7b0jA	0.688	0.983	1.857E-68	682	0.623	0.893	7b0jA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
5	PDB:7b1gA	0.694	0.978	3.849E-65	691	0.617	0.873	7b1gA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
6	PDB:6ysnA	0.607	0.973	1.307E-54	606	0.527	0.850	6ysnA.pdb.gz	Human TRPC5 structures reveal interaction of a xanthine-based TRPC1/4/5 inhibitor with a conserved lipid binding site.
7	AFDB:Q9PRI8	0.719	0.897	6.279E-53	778	0.357	0.449	Q9PRI8.pdb.gz	Q9PRI8_XENLA Short transient receptor potential channel 1 OS=Xenopus laevis OX=8355 GN=trpc1.L PE=2 SV=1
8	AFDB:C0JJ14	0.646	0.820	3.841E-50	760	0.347	0.446	C0JJ14.pdb.gz	C0JJ14_PIG Short transient receptor potential channel 1 OS=Sus scrofa OX=9823 GN=TRPC1 PE=2 SV=1
9	AFDB:F1LQF7	0.679	0.766	3.554E-46	862	0.331	0.375	F1LQF7.pdb.gz	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
10	AFDB:Q9Y210	0.680	0.712	3.222E-45	931	0.329	0.345	Q9Y210.pdb.gz	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
11	PDB:7dxgA	0.649	0.895	1.535E-40	698	0.310	0.434	7dxgA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
12	PDB:6uz8A	0.647	0.851	1.391E-39	734	0.310	0.413	6uz8A.pdb.gz	Structural basis for pharmacological modulation of the TRPC6 channel.
13	PDB:7dxbA	0.644	0.844	2.062E-39	738	0.314	0.416	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
14	PDB:5yx9A	0.630	0.898	2.513E-35	675	0.301	0.436	5yx9A.pdb.gz
15	PDB:5zbgA	0.631	0.909	3.444E-35	670	0.297	0.433	5zbgA.pdb.gz
16	PDB:5vkqA	0.382	0.260	2.074E-15	1499	0.143	0.093	5vkqA.pdb.gz
17	PDB:6co7A	0.414	0.385	5.029E-14	1061	0.150	0.139	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
18	AFDB:Q13936	0.188	0.094	3.882E-4	2221	0.141	0.062	Q13936.pdb.gz	CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens OX=9606 GN=CACNA1C PE=1 SV=4
19	AFDB:Q9H3S7	0.108	0.074	9.600E-4	1636	0.104	0.062	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
20	AFDB:Q98SV4	0.186	0.216	9.986E-4	816	0.083	0.099	Q98SV4.pdb.gz	Q98SV4_ICTPU Delayed rectifier potassium channel Kv2 OS=Ictalurus punctatus OX=7998 GN=kcnb2b PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K149	1265	962	0.650	0.660	A0A0G2K149_RAT Transient receptor potential cation channel, subfamily C, member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=4 SV=2
2	A0A0R4IM91	1419	915	0.708	0.756	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
3	A0A8I6ATX7	558	800	0.328	0.400	A0A8I6ATX7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
4	C0JJ14	644	760	0.364	0.468	C0JJ14_PIG Short transient receptor potential channel 1 OS=Sus scrofa OX=9823 GN=TRPC1 PE=2 SV=1
5	E1U7G1	672	796	0.375	0.460	E1U7G1_DANRE Short transient receptor potential channel 1 OS=Danio rerio OX=7955 GN=trpc1 PE=2 SV=1
6	F1LQF7	569	862	0.336	0.381	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
7	O35119	1960	977	0.970	0.970	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
8	P19334	607	1275	0.353	0.271	TRP_DROME Transient receptor potential protein OS=Drosophila melanogaster OX=7227 GN=trp PE=1 SV=3
9	P48994	664	1124	0.360	0.313	TRPL_DROME Transient-receptor-potential-like protein OS=Drosophila melanogaster OX=7227 GN=trpl PE=1 SV=2
10	P48995	685	793	0.379	0.467	TRPC1_HUMAN Short transient receptor potential channel 1 OS=Homo sapiens OX=9606 GN=TRPC1 PE=1 SV=1
11	Q61056	683	793	0.378	0.465	TRPC1_MOUSE Short transient receptor potential channel 1 OS=Mus musculus OX=10090 GN=Trpc1 PE=1 SV=5
12	Q8VD38	1290	974	0.656	0.658	Q8VD38_RAT Transient receptor potential cation channel subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=2 SV=1
13	Q9HCX4	568	862	0.334	0.378	TRPC7_HUMAN Short transient receptor potential channel 7 OS=Homo sapiens OX=9606 GN=TRPC7 PE=1 SV=1
14	Q9PRI8	668	778	0.369	0.464	Q9PRI8_XENLA Short transient receptor potential channel 1 OS=Xenopus laevis OX=8355 GN=trpc1.L PE=2 SV=1
15	Q9QUQ5	1957	974	0.969	0.972	TRPC4_MOUSE Short transient receptor potential channel 4 OS=Mus musculus OX=10090 GN=Trpc4 PE=1 SV=1
16	Q9QX01	640	759	0.362	0.466	TRPC1_RAT Short transient receptor potential channel 1 OS=Rattus norvegicus OX=10116 GN=Trpc1 PE=1 SV=1
17	Q9QX29	1290	975	0.649	0.650	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
18	Q9UBN4	2021	977	1.000	1.000	TRPC4_HUMAN Short transient receptor potential channel 4 OS=Homo sapiens OX=9606 GN=TRPC4 PE=1 SV=1
19	Q9UL62	1283	973	0.653	0.656	TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens OX=9606 GN=TRPC5 PE=1 SV=1
20	Q9VJJ7	825	1128	0.418	0.362	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.23	23.2	Ankyrin repeat
2	PF12796 Ank_2	7.2e-06	37.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.0094	27.3	Ankyrin repeat
4	PF13637 Ank_4	3.6e-06	38.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.94	21.1	Ankyrin repeats (many copies)
6	PF05823 Gp-FAR-1	5.7e+02	12.3	Nematode fatty acid retinoid binding protein (Gp-FAR-1)
7	PF00520 Ion_trans	2.6e-29	113.7	Ion transport protein
8	PF08016 PKD_channel	0.18	22.7	Polycystin cation channel
9	PF08344 TRP_2	1.9e-24	96.9	Transient receptor ion channel II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262613	0.990	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
2	9606.ENSP00000345259	0.967	Protein 4.1
3	9606.ENSP00000419313	0.939	Short transient receptor potential channel 1
4	9606.ENSP00000478059	0.901	Stromal interaction molecule 1
5	9606.ENSP00000262839	0.864	Short transient receptor potential channel 5
6	9606.ENSP00000385019	0.844	Voltage-dependent T-type calcium channel subunit alpha-1I
7	9606.ENSP00000352011	0.843	Voltage-dependent T-type calcium channel subunit alpha-1G
8	9606.ENSP00000334198	0.839	Voltage-dependent T-type calcium channel subunit alpha-1H
9	9606.ENSP00000306253	0.835	Inositol 1,4,5-trisphosphate receptor type 1
10	9606.ENSP00000244007	0.829	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
11	9606.ENSP00000480616	0.825	Calcium release-activated calcium channel protein 1
12	9606.ENSP00000252015	0.822	Short transient receptor potential channel 4-associated protein
13	9606.ENSP00000363708	0.818	Bone morphogenetic protein receptor type-2
14	9606.ENSP00000363435	0.815	Inositol 1,4,5-trisphosphate receptor type 3
15	9606.ENSP00000262209	0.802	Transient receptor potential cation channel subfamily A member 1
16	9606.ENSP00000339191	0.801	Caveolin-1
17	9606.ENSP00000406191	0.801	Transient receptor potential cation channel subfamily V member 4
18	9606.ENSP00000344115	0.796	Cadherin-5
19	9606.ENSP00000319486	0.764	Tetraspanin-16
20	9606.ENSP00000368966	0.752	Short transient receptor potential channel 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005262	1.000	calcium channel activity
GO:0005515	0.999	protein binding
GO:0043168	0.855	anion binding
GO:0043178	0.842	alcohol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.993	transport
GO:0009987	0.986	cellular process
GO:0006811	0.967	monoatomic ion transport
GO:0006812	0.954	monoatomic cation transport
GO:0006816	0.938	calcium ion transport
GO:0065007	0.847	biological regulation
GO:0050789	0.812	regulation of biological process
GO:0055085	0.562	transmembrane transport
GO:0098662	0.537	inorganic cation transmembrane transport
GO:0034220	0.536	monoatomic ion transmembrane transport
GO:0098655	0.534	monoatomic cation transmembrane transport
GO:0050794	0.489	regulation of cellular process
GO:0032501	0.480	multicellular organismal process
GO:0070588	0.446	calcium ion transmembrane transport
GO:0048518	0.420	positive regulation of biological process
GO:0050896	0.380	response to stimulus
GO:0065008	0.333	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.993	protein-containing complex
GO:0005622	0.946	intracellular anatomical structure
GO:0005737	0.937	cytoplasm
GO:0043226	0.882	organelle
GO:0043229	0.711	intracellular organelle
GO:0043227	0.605	membrane-bounded organelle
GO:0098590	0.425	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]