StarFunc result for job id Q9UBN7

User Input

>input (1215 residues)
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZ26	0.640	0.640	0.000	1215	1.000	1.000	A0A024QZ26.pdb.gz
2	AFDB:D3ZVD8	0.697	0.731	0.000	1155	0.747	0.785	D3ZVD8.pdb.gz	D3ZVD8_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=3
3	AFDB:Q969S8	0.468	0.835	1.514E-62	669	0.225	0.408	Q969S8.pdb.gz	HDA10_HUMAN Polyamine deacetylase HDAC10 OS=Homo sapiens OX=9606 GN=HDAC10 PE=1 SV=1
4	AFDB:F1QCV2	0.475	0.838	4.524E-61	675	0.208	0.375	F1QCV2.pdb.gz	HDA10_DANRE Polyamine deacetylase HDAC10 OS=Danio rerio OX=7955 GN=hdac10 PE=1 SV=2
5	PDB:5eduB	0.291	0.489	2.634E-59	723	0.291	0.490	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
6	PDB:7sggA	0.464	0.858	1.113E-58	644	0.204	0.385	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
7	PDB:6uijA	0.467	0.894	5.939E-56	620	0.206	0.403	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
8	AFDB:Q569C4	0.402	0.800	1.154E-48	588	0.193	0.400	Q569C4.pdb.gz	HDA10_RAT Polyamine deacetylase HDAC10 OS=Rattus norvegicus OX=10116 GN=Hdac10 PE=2 SV=1
9	PDB:6z6fB	0.288	0.522	2.279E-32	661	0.131	0.241	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
10	PDB:5ikkA	0.252	0.504	5.917E-30	594	0.129	0.264	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
11	PDB:5g0yB	0.265	0.819	4.256E-24	377	0.091	0.294	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
12	PDB:7zzuB	0.252	0.786	1.343E-18	371	0.071	0.232	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
13	PDB:4qa0A	0.246	0.769	3.223E-18	371	0.067	0.218	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
14	PDB:3sfhA	0.237	0.792	2.659E-17	342	0.069	0.246	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
15	PDB:4fjcE	0.055	0.145	8.898E-4	434	0.018	0.051	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
16	AFDB:Q9BX63	0.057	0.056	9.293E-1	1249	0.061	0.059	Q9BX63.pdb.gz	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
17	AFDB:A0A0B4KFM5	0.066	0.068	1.723	1111	0.069	0.076	A0A0B4KFM5.pdb.gz	A0A0B4KFM5_DROME Reduction in Cnn dots 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
18	AFDB:Q6ZN04	0.033	0.062	1.723	569	0.044	0.095	Q6ZN04.pdb.gz	MEX3B_HUMAN RNA-binding protein MEX3B OS=Homo sapiens OX=9606 GN=MEX3B PE=1 SV=1
19	AFDB:Q69Z36	0.041	0.060	1.815	601	0.044	0.090	Q69Z36.pdb.gz	MEX3B_MOUSE RNA-binding protein MEX3B OS=Mus musculus OX=10090 GN=Mex3b PE=2 SV=2
20	AFDB:A0A024RAR2	0.046	0.066	2.602	665	0.049	0.090	A0A024RAR2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2QC41	0.0	1790	1157	0.745	0.782	A0A0G2QC41_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=2
2	A0A1L5YJQ7	0.0	1809	1152	0.747	0.788	A0A1L5YJQ7_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=2 SV=1
3	A0A2R8YDE6	0.0	2397	1160	0.955	1.000	A0A2R8YDE6_HUMAN Histone deacetylase 6 OS=Homo sapiens OX=9606 GN=HDAC6 PE=1 SV=1
4	A0A8I6GM68	0.0	1796	1183	0.748	0.768	A0A8I6GM68_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=1
5	A7YT55	0.0	818	929	0.347	0.454	A7YT55_DANRE Hdac6 protein (Fragment) OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1
6	D3ZVD8	0.0	1814	1189	0.748	0.765	D3ZVD8_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=3
7	F8W4B7	0.0	939	1081	0.389	0.438	F8W4B7_DANRE Histone deacetylase 6 OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1
8	M9NEH6	0.0	699	1022	0.307	0.365	M9NEH6_DROME Histone deacetylase 6, isoform F OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
9	M9NGF7	0.0	698	1108	0.309	0.339	M9NGF7_DROME Histone deacetylase 6, isoform E OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
10	M9PJN5	0.0	697	1179	0.309	0.319	M9PJN5_DROME Histone deacetylase 6, isoform G OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
11	Q86NK9	0.0	699	1128	0.309	0.333	Q86NK9_DROME Histone deacetylase 6 isoform A OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
12	Q8IR37	0.0	699	1138	0.309	0.330	Q8IR37_DROME Histone deacetylase 6 isoform C OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
13	Q8IR38	0.0	698	1135	0.309	0.331	Q8IR38_DROME Histone deacetylase 6 isoform B OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
14	Q9UBN7	0.0	2514	1215	1.000	1.000	HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens OX=9606 GN=HDAC6 PE=1 SV=2
15	Q9XYX1	0.0	694	883	0.299	0.411	Q9XYX1_DROME HDAC6 OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
16	Q9Z2V5	0.0	1768	1149	0.747	0.789	HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus OX=10090 GN=Hdac6 PE=1 SV=3
17	Q969S8	6.28e-127	407	669	0.160	0.291	HDA10_HUMAN Polyamine deacetylase HDAC10 OS=Homo sapiens OX=9606 GN=HDAC10 PE=1 SV=1
18	F1QCV2	1.92e-121	393	675	0.148	0.267	HDA10_DANRE Polyamine deacetylase HDAC10 OS=Danio rerio OX=7955 GN=hdac10 PE=1 SV=2
19	Q569C4	5.84e-103	340	588	0.141	0.291	HDA10_RAT Polyamine deacetylase HDAC10 OS=Rattus norvegicus OX=10116 GN=Hdac10 PE=2 SV=1
20	Q5A960	6.89e-97	330	833	0.136	0.198	HDA1_CANAL Histone deacetylase HDA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HDA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00850 Hist_deacetyl	1e-176	598.3	Histone deacetylase domain
2	PF02148 zf-UBP	2.6e-13	61.4	Zn-finger in ubiquitin-hydrolases and other protein
3	PF17807 zf-UBP_var	1.8e+02	13.4	Variant UBP zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334061

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
2	9606.ENSP00000351777	0.997	Transitional endoplasmic reticulum ATPase
3	9606.ENSP00000360493	0.997	Runt-related transcription factor 2
4	9606.ENSP00000482075	0.990	Prostaglandin E synthase 3
5	9606.ENSP00000441543	0.988	Polyubiquitin-C
6	9606.ENSP00000240185	0.987	TAR DNA-binding protein 43
7	9606.ENSP00000249396	0.986	NAD-dependent protein deacetylase sirtuin-2
8	9606.ENSP00000263253	0.986	Histone acetyltransferase p300
9	9606.ENSP00000426809	0.983	Prominin-1
10	9606.ENSP00000377681	0.981	Ras GTPase-activating protein-binding protein 1
11	9606.ENSP00000336799	0.980	Tubulin alpha-1B chain
12	9606.ENSP00000365745	0.980	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
13	9606.ENSP00000374455	0.977	Sequestosome-1
14	9606.ENSP00000369703	0.970	Tubulin beta-2A chain
15	9606.ENSP00000231509	0.969	Glucocorticoid receptor
16	9606.ENSP00000360609	0.966	Heat shock protein HSP 90-beta
17	9606.ENSP00000478320	0.959	Ataxin-3
18	9606.ENSP00000295757	0.956	Histone deacetylase 11
19	9606.ENSP00000384849	0.953	Cyclin-dependent kinase inhibitor 1
20	9606.ENSP00000344456	0.951	Catenin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019213	0.999	deacetylase activity
GO:0016811	0.999	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0033558	0.992	protein lysine deacetylase activity
GO:0004407	0.938	histone deacetylase activity
GO:0019899	0.339	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0048518	0.985	positive regulation of biological process
GO:0019222	0.985	regulation of metabolic process
GO:0048522	0.984	positive regulation of cellular process
GO:0071704	0.981	organic substance metabolic process
GO:0051246	0.978	regulation of protein metabolic process
GO:0051128	0.977	regulation of cellular component organization
GO:0048583	0.975	regulation of response to stimulus
GO:0044238	0.969	primary metabolic process
GO:0010646	0.968	regulation of cell communication
GO:0023051	0.967	regulation of signaling
GO:0071840	0.966	cellular component organization or biogenesis
GO:0042221	0.962	response to chemical
GO:0031323	0.960	regulation of cellular metabolic process
GO:0065008	0.959	regulation of biological quality
GO:0031399	0.958	regulation of protein modification process
GO:0006807	0.957	nitrogen compound metabolic process
GO:0016043	0.955	cellular component organization
GO:0006950	0.948	response to stress
GO:0032886	0.945	regulation of microtubule-based process
GO:0043170	0.942	macromolecule metabolic process
GO:0010605	0.941	negative regulation of macromolecule metabolic process
GO:0010941	0.937	regulation of cell death
GO:0048523	0.930	negative regulation of cellular process
GO:0010033	0.919	response to organic substance
GO:0051646	0.911	mitochondrion localization
GO:0046907	0.901	intracellular transport
GO:0080135	0.895	regulation of cellular response to stress
GO:0099111	0.875	microtubule-based transport
GO:0051172	0.875	negative regulation of nitrogen compound metabolic process
GO:0007017	0.868	microtubule-based process
GO:0034643	0.862	establishment of mitochondrion localization, microtubule-mediated
GO:0051716	0.848	cellular response to stimulus
GO:0019538	0.845	protein metabolic process
GO:0033554	0.837	cellular response to stress
GO:0036211	0.830	protein modification process
GO:1902882	0.814	regulation of response to oxidative stress
GO:0070887	0.798	cellular response to chemical stimulus
GO:0033043	0.791	regulation of organelle organization
GO:0030705	0.791	cytoskeleton-dependent intracellular transport
GO:1903201	0.750	regulation of oxidative stress-induced cell death
GO:0009893	0.748	positive regulation of metabolic process
GO:0010970	0.734	transport along microtubule
GO:0010604	0.703	positive regulation of macromolecule metabolic process
GO:0051173	0.696	positive regulation of nitrogen compound metabolic process
GO:0051129	0.684	negative regulation of cellular component organization
GO:0072384	0.681	organelle transport along microtubule
GO:0008088	0.670	axo-dendritic transport
GO:0047497	0.633	mitochondrion transport along microtubule
GO:0051247	0.584	positive regulation of protein metabolic process
GO:0032501	0.582	multicellular organismal process
GO:0051248	0.492	negative regulation of protein metabolic process
GO:0010468	0.482	regulation of gene expression
GO:0019219	0.456	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.449	positive regulation of cellular metabolic process
GO:0009889	0.435	regulation of biosynthetic process
GO:0044237	0.434	cellular metabolic process
GO:0032502	0.430	developmental process
GO:0031326	0.421	regulation of cellular biosynthetic process
GO:0048856	0.417	anatomical structure development
GO:0010556	0.416	regulation of macromolecule biosynthetic process
GO:0031324	0.409	negative regulation of cellular metabolic process
GO:0019220	0.405	regulation of phosphate metabolic process
GO:0001932	0.401	regulation of protein phosphorylation
GO:0051252	0.396	regulation of RNA metabolic process
GO:2001141	0.393	regulation of RNA biosynthetic process
GO:0031401	0.385	positive regulation of protein modification process
GO:0034599	0.378	cellular response to oxidative stress
GO:0098930	0.367	axonal transport
GO:0071310	0.364	cellular response to organic substance
GO:0051239	0.360	regulation of multicellular organismal process
GO:1903506	0.359	regulation of nucleic acid-templated transcription
GO:0007275	0.356	multicellular organism development
GO:0006355	0.354	regulation of DNA-templated transcription
GO:0031400	0.323	negative regulation of protein modification process
GO:0045595	0.318	regulation of cell differentiation
GO:0006996	0.316	organelle organization
GO:0010942	0.306	positive regulation of cell death
GO:0048731	0.302	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.952	intracellular non-membrane-bounded organelle
GO:0005737	0.874	cytoplasm
GO:0005829	0.465	cytosol
GO:0032991	0.424	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	0.999	In linear amides.
RHEA:58108	0.992	H2O + N(6)-acetyl-L-lysyl-[protein] = acetate + L-lysyl-[protein]
RHEA:58196	0.938	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.938	histone deacetylase.

[back to server]