StarFunc result for job id Q9UBP4

User Input

>input (350 residues)
MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED
TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITN
NQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTR
DSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGEL
CHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILL
PREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBP4	1.000	1.000	7.812E-61	350	1.000	1.000	Q9UBP4.pdb.gz	DKK3_HUMAN Dickkopf-related protein 3 OS=Homo sapiens OX=9606 GN=DKK3 PE=1 SV=2
2	AFDB:Q9QUN9	0.759	0.761	3.490E-54	349	0.823	0.825	Q9QUN9.pdb.gz	DKK3_MOUSE Dickkopf-related protein 3 OS=Mus musculus OX=10090 GN=Dkk3 PE=2 SV=1
3	AFDB:A0A0R4IQS3	0.431	0.504	2.190E-19	293	0.289	0.345	A0A0R4IQS3.pdb.gz
4	AFDB:Q9UK85	0.171	0.245	1.572E-5	242	0.091	0.132	Q9UK85.pdb.gz	DKKL1_HUMAN Dickkopf-like protein 1 OS=Homo sapiens OX=9606 GN=DKKL1 PE=1 SV=1
5	AFDB:A5JV83	0.122	0.193	1.082E-3	205	0.083	0.141	A5JV83.pdb.gz	HSPBB_DANRE Heat shock protein beta-11 OS=Danio rerio OX=7955 GN=hspb11 PE=2 SV=2
6	AFDB:Q9QZL9	0.136	0.201	3.685E-3	230	0.077	0.117	Q9QZL9.pdb.gz	DKKL1_MOUSE Dickkopf-like protein 1 OS=Mus musculus OX=10090 GN=Dkkl1 PE=1 SV=2
7	AFDB:Q38BI4	0.135	0.126	1.186E-2	387	0.049	0.044	Q38BI4.pdb.gz	Q38BI4_TRYB2 RING-type E3 ubiquitin transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3100 PE=4 SV=1
8	AFDB:Q14990	0.110	0.154	1.852E-2	250	0.077	0.108	Q14990.pdb.gz	ODFP1_HUMAN Outer dense fiber protein 1 OS=Homo sapiens OX=9606 GN=ODF1 PE=1 SV=2
9	AFDB:Q921U8	0.107	0.050	2.891E-2	923	0.126	0.048	Q921U8.pdb.gz	SMTN_MOUSE Smoothelin OS=Mus musculus OX=10090 GN=Smtn PE=1 SV=2
10	AFDB:Q9VQI8	0.088	0.070	5.046E-2	464	0.034	0.026	Q9VQI8.pdb.gz	Q9VQI8_DROME FI18627p1 OS=Drosophila melanogaster OX=7227 GN=NTPase PE=1 SV=1
11	PDB:7pdzE	0.072	0.084	1.626E-1	272	0.017	0.022	7pdzE.pdb.gz	A barbed end interference mechanism reveals how capping protein promotes nucleation in branched actin networks.
12	PDB:5fywU	0.070	0.246	2.838E-1	92	0.034	0.130	5fywU.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
13	PDB:7ohaM	0.089	0.200	3.172E-1	107	0.034	0.112	7ohaM.pdb.gz	Structures and implications of TBP-nucleosome complexes.
14	PDB:7kzpQ	0.109	0.052	4.684E-1	754	0.029	0.013	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
15	PDB:3ff0A	0.070	0.115	5.236E-1	162	0.020	0.043	3ff0A.pdb.gz
16	PDB:3ul5D	0.083	0.257	5.236E-1	84	0.020	0.083	3ul5D.pdb.gz
17	PDB:3qvcA	0.091	0.087	6.917E-1	368	0.017	0.016	3qvcA.pdb.gz
18	PDB:7mkuA	0.101	0.114	6.917E-1	302	0.046	0.053	7mkuA.pdb.gz
19	PDB:7r5jD4	0.045	0.017	6.917E-1	1312	0.026	0.007	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:1g9qA	0.083	0.129	7.731E-1	205	0.029	0.049	1g9qA.pdb.gz	The structure of ADP-ribose pyrophosphatase reveals the structural basis for the versatility of the Nudix family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9QUN9	0.0	554	349	0.823	0.825	DKK3_MOUSE Dickkopf-related protein 3 OS=Mus musculus OX=10090 GN=Dkk3 PE=2 SV=1
2	Q9UBP4	0.0	720	350	1.000	1.000	DKK3_HUMAN Dickkopf-related protein 3 OS=Homo sapiens OX=9606 GN=DKK3 PE=1 SV=2
3	C1K6H6	4.79e-60	196	293	0.303	0.362	C1K6H6_DANRE Dickkopf long isoform OS=Danio rerio OX=7955 GN=dkk3 PE=2 SV=1
4	Q9UBT3	1.14e-09	60.1	224	0.171	0.268	DKK4_HUMAN Dickkopf-related protein 4 OS=Homo sapiens OX=9606 GN=DKK4 PE=1 SV=1
5	Q9UK85	1.59e-08	57.0	242	0.069	0.099	DKKL1_HUMAN Dickkopf-like protein 1 OS=Homo sapiens OX=9606 GN=DKKL1 PE=1 SV=1
6	Q9QZL9	3.15e-07	52.8	230	0.063	0.096	DKKL1_MOUSE Dickkopf-like protein 1 OS=Mus musculus OX=10090 GN=Dkkl1 PE=1 SV=2
7	Q9PWH3	3.47e-04	43.9	240	0.134	0.196	Q9PWH3_DANRE Dickkopf WNT-signaling pathway inhibitor 1b OS=Danio rerio OX=7955 GN=DKK1 PE=2 SV=1
8	O57464	0.003	40.8	259	0.071	0.097	O57464_XENLA Dickkopf WNT signaling pathway inhibitor 1 S homeolog precursor OS=Xenopus laevis OX=8355 GN=dkk1.S PE=2 SV=1
9	O94907	0.004	40.8	266	0.071	0.094	DKK1_HUMAN Dickkopf-related protein 1 OS=Homo sapiens OX=9606 GN=DKK1 PE=1 SV=1
10	Q9W6D9	0.004	40.8	241	0.131	0.191	Q9W6D9_DANRE Dickkopf-1 OS=Danio rerio OX=7955 GN=dkk1 PE=2 SV=1
11	O54908	0.005	40.4	272	0.071	0.092	DKK1_MOUSE Dickkopf-related protein 1 OS=Mus musculus OX=10090 GN=Dkk1 PE=1 SV=2
12	A8KB56	0.006	40.0	243	0.083	0.119	A8KB56_DANRE Dickkopf-related protein 2 precursor OS=Danio rerio OX=7955 GN=dkk2 PE=2 SV=1
13	Q8VEJ3	0.006	40.0	221	0.080	0.127	DKK4_MOUSE Dickkopf-related protein 4 OS=Mus musculus OX=10090 GN=Dkk4 PE=2 SV=1
14	Q9UBU2	0.017	38.9	259	0.129	0.174	DKK2_HUMAN Dickkopf-related protein 2 OS=Homo sapiens OX=9606 GN=DKK2 PE=1 SV=1
15	A8WGT5	0.049	37.4	255	0.074	0.102	A8WGT5_DANRE LOC799377 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC799377 PE=2 SV=1
16	O14014	0.080	37.4	969	0.083	0.030	RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga3 PE=1 SV=1
17	Q9QYZ8	0.21	35.4	259	0.126	0.170	DKK2_MOUSE Dickkopf-related protein 2 OS=Mus musculus OX=10090 GN=Dkk2 PE=1 SV=2
18	Q14A28	0.77	32.3	105	0.074	0.248	PROK1_MOUSE Prokineticin-1 OS=Mus musculus OX=10090 GN=Prok1 PE=1 SV=1
19	Q8R414	0.99	32.0	105	0.074	0.248	PROK1_RAT Prokineticin-1 OS=Rattus norvegicus OX=10116 GN=Prok1 PE=3 SV=1
20	O14072	1.1	33.9	1211	0.071	0.021	ATC4_SCHPO Endoplasmic reticulum transmembrane helix translocase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cta4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01874 CitG	2.1e+02	12.9	ATP:dephospho-CoA triphosphoribosyl transferase
2	PF04706 Dickkopf_N	3.3e-13	61.1	Dickkopf N-terminal cysteine-rich region
3	PF07743 HSCB_C	8.7e+02	11.8	HSCB C-terminal oligomerisation domain
4	PF00921 Lipoprotein_2	1.8e+02	13.1	Borrelia lipoprotein
5	PF05300 MIC19_MIC25	45	15.6	MICOS complex subunit MIC19/MIC25
6	PF11703 UPF0506	18	17.1	UPF0506

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379762

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294304	0.986	Low-density lipoprotein receptor-related protein 5
2	9606.ENSP00000261349	0.874	Low-density lipoprotein receptor-related protein 6
3	9606.ENSP00000285311	0.856	Dickkopf-related protein 2
4	9606.ENSP00000356056	0.832	Dynein light chain Tctex-type 1
5	9606.ENSP00000331242	0.823	Kremen protein 1
6	9606.ENSP00000363081	0.818	Dickkopf-related protein 1
7	9606.ENSP00000220772	0.799	Secreted frizzled-related protein 1
8	9606.ENSP00000344456	0.792	Catenin beta-1
9	9606.ENSP00000286574	0.743	Wnt inhibitory factor 1
10	9606.ENSP00000274063	0.735	Secreted frizzled-related protein 2
11	9606.ENSP00000233948	0.734	Protein Wnt-6
12	9606.ENSP00000358698	0.732	Protein Wnt-2b
13	9606.ENSP00000266066	0.705	Secreted frizzled-related protein 5
14	9606.ENSP00000410715	0.703	Secreted frizzled-related protein 4
15	9606.ENSP00000359206	0.699	F-box/WD repeat-containing protein 1A
16	9606.ENSP00000295113	0.683	Secreted frizzled-related protein 3
17	9606.ENSP00000483552	0.632	Furin
18	9606.ENSP00000264634	0.615	Protein Wnt-5a
19	9606.ENSP00000265441	0.604	Protein Wnt-2
20	9606.ENSP00000221566	0.573	Small glutamine-rich tetratricopeptide repeat-containing protein alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.990	regulation of primary metabolic process
GO:0009968	0.988	negative regulation of signal transduction
GO:0031323	0.987	regulation of cellular metabolic process
GO:0048856	0.986	anatomical structure development
GO:0009889	0.985	regulation of biosynthetic process
GO:0030111	0.985	regulation of Wnt signaling pathway
GO:0032501	0.984	multicellular organismal process
GO:0009892	0.983	negative regulation of metabolic process
GO:0031326	0.979	regulation of cellular biosynthetic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0048513	0.973	animal organ development
GO:0048731	0.968	system development
GO:0065008	0.958	regulation of biological quality
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0010468	0.953	regulation of gene expression
GO:0030178	0.946	negative regulation of Wnt signaling pathway
GO:0060828	0.929	regulation of canonical Wnt signaling pathway
GO:0006355	0.928	regulation of DNA-templated transcription
GO:0010605	0.921	negative regulation of macromolecule metabolic process
GO:0019216	0.890	regulation of lipid metabolic process
GO:0046890	0.868	regulation of lipid biosynthetic process
GO:0031324	0.861	negative regulation of cellular metabolic process
GO:0051172	0.858	negative regulation of nitrogen compound metabolic process
GO:0009890	0.847	negative regulation of biosynthetic process
GO:0019218	0.731	regulation of steroid metabolic process
GO:0035270	0.715	endocrine system development
GO:0050810	0.714	regulation of steroid biosynthetic process
GO:0009653	0.709	anatomical structure morphogenesis
GO:0062012	0.700	regulation of small molecule metabolic process
GO:0048732	0.695	gland development
GO:0045833	0.695	negative regulation of lipid metabolic process
GO:0090090	0.690	negative regulation of canonical Wnt signaling pathway
GO:1902930	0.682	regulation of alcohol biosynthetic process
GO:0010566	0.671	regulation of ketone biosynthetic process
GO:0030325	0.655	adrenal gland development
GO:0051055	0.653	negative regulation of lipid biosynthetic process
GO:0010817	0.617	regulation of hormone levels
GO:0009987	0.563	cellular process
GO:0032350	0.519	regulation of hormone metabolic process
GO:0010558	0.452	negative regulation of macromolecule biosynthetic process
GO:0031327	0.449	negative regulation of cellular biosynthetic process
GO:0051253	0.437	negative regulation of RNA metabolic process
GO:0045892	0.393	negative regulation of DNA-templated transcription
GO:0050896	0.385	response to stimulus
GO:0048518	0.361	positive regulation of biological process
GO:0062014	0.322	negative regulation of small molecule metabolic process
GO:0048522	0.320	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.472	cell periphery
GO:0005622	0.392	intracellular anatomical structure
GO:0043226	0.388	organelle
GO:0043231	0.359	intracellular membrane-bounded organelle
GO:0005737	0.330	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]