StarFunc result for job id Q9UBP5

User Input

>input (337 residues)
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V7S6	0.633	0.630	2.128E-42	339	0.947	0.941	G3V7S6.pdb.gz	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
2	AFDB:Q9I9L0	0.537	0.557	1.346E-34	324	0.769	0.799	Q9I9L0.pdb.gz	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
3	AFDB:Q9Y5J3	0.428	0.471	1.344E-22	304	0.516	0.572	Q9Y5J3.pdb.gz	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
4	AFDB:Q9I8A3	0.421	0.476	2.080E-22	294	0.493	0.565	Q9I8A3.pdb.gz	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1
5	AFDB:Q8AXV6	0.382	0.404	8.731E-22	317	0.463	0.492	Q8AXV6.pdb.gz	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
6	AFDB:Q9NQ87	0.397	0.407	6.129E-18	328	0.430	0.442	Q9NQ87.pdb.gz	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
7	AFDB:Q9DBX7	0.362	0.374	9.484E-18	326	0.436	0.451	Q9DBX7.pdb.gz	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
8	AFDB:Q7KM13	0.240	0.195	5.817E-16	425	0.359	0.285	Q7KM13.pdb.gz	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
9	AFDB:A7MCR9	0.212	0.228	8.235E-9	291	0.264	0.306	A7MCR9.pdb.gz
10	AFDB:Q2PGD2	0.183	0.148	1.131E-7	421	0.249	0.200	Q2PGD2.pdb.gz	Q2PGD2_DANRE BHLH protein DEC2 OS=Danio rerio OX=7955 GN=bhlhb3l PE=2 SV=1
11	PDB:6qw65A	0.090	0.021	1.279	2212	0.071	0.011	6qw65A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:6e0cA	0.106	0.301	1.747	99	0.053	0.182	6e0cA.pdb.gz	Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
13	PDB:5mrcR	0.092	0.093	1.860	331	0.071	0.073	5mrcR.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:7mq8LJ	0.090	0.069	2.704	469	0.074	0.053	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:2ahzA	0.159	0.424	3.470	105	0.039	0.124	2ahzA.pdb.gz
16	PDB:4wa6B	0.087	0.231	3.470	96	0.024	0.083	4wa6B.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
17	PDB:7o4i1	0.144	0.100	3.693	522	0.059	0.038	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
18	PDB:7suk5	0.120	0.134	3.693	296	0.071	0.081	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
19	PDB:5n9jV	0.150	0.415	3.931	99	0.027	0.091	5n9jV.pdb.gz
20	PDB:3ojaA	0.125	0.095	4.184	482	0.059	0.041	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V7S6	0.0	553	339	0.947	0.941	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
2	Q9QUS4	0.0	549	339	0.941	0.935	HEY2_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Mus musculus OX=10090 GN=Hey2 PE=1 SV=1
3	Q9UBP5	0.0	686	337	1.000	1.000	HEY2_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Homo sapiens OX=9606 GN=HEY2 PE=1 SV=1
4	Q9I9L0	3.98e-160	452	324	0.766	0.796	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
5	Q9Y5J3	2.08e-100	300	304	0.555	0.615	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
6	Q9WV93	9.59e-90	272	299	0.516	0.582	HEY1_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Mus musculus OX=10090 GN=Hey1 PE=1 SV=1
7	Q9I8A3	1.57e-89	271	294	0.496	0.568	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1
8	A0A8I5ZYX7	3.93e-88	278	617	0.510	0.279	A0A8I5ZYX7_RAT Hes-related family bHLH transcription factor with YRPW motif 1 OS=Rattus norvegicus OX=10116 GN=Hey1 PE=4 SV=1
9	Q8AXV6	1.89e-79	247	317	0.359	0.382	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
10	Q8VIH5	7.18e-71	220	177	0.481	0.915	Q8VIH5_RAT HES-related repressor protein 1 HERP1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
11	Q9NQ87	1.08e-68	219	328	0.341	0.351	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
12	Q9DBX7	1.75e-68	219	326	0.332	0.344	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
13	Q7KM13	1.63e-52	180	425	0.273	0.216	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
14	Q6PBX3	4.93e-26	106	270	0.187	0.233	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
15	Q26263	2.95e-25	107	435	0.243	0.189	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
16	Q9DF41	7.35e-25	103	291	0.291	0.337	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
17	Q90VV1	1.51e-23	100	277	0.154	0.188	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
18	Q6XLQ0	1.83e-23	100	290	0.226	0.262	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
19	O57337	1.99e-23	100	290	0.228	0.266	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
20	Q04666	2.95e-23	99.4	281	0.166	0.199	HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus OX=10116 GN=Hes1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07527 Hairy_orange	2.3e-10	51.9	Hairy Orange
2	PF00010 HLH	5.4e-14	63.2	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357348

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.985	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000345206	0.981	Recombining binding protein suppressor of hairless
3	9606.ENSP00000338272	0.976	Hairy/enhancer-of-split related with YRPW motif protein 1
4	9606.ENSP00000263388	0.975	Neurogenic locus notch homolog protein 3
5	9606.ENSP00000334458	0.973	Transcription factor GATA-4
6	9606.ENSP00000364163	0.973	Neurogenic locus notch homolog protein 4
7	9606.ENSP00000269216	0.954	Transcription factor GATA-6
8	9606.ENSP00000351407	0.954	Aryl hydrocarbon receptor nuclear translocator
9	9606.ENSP00000292599	0.944	Mastermind-like protein 1
10	9606.ENSP00000437955	0.931	Hypoxia-inducible factor 1-alpha
11	9606.ENSP00000360493	0.926	Runt-related transcription factor 2
12	9606.ENSP00000261531	0.920	SNW domain-containing protein 1
13	9606.ENSP00000434552	0.917	Mastermind-like protein 2
14	9606.ENSP00000361943	0.915	Hairy/enhancer-of-split related with YRPW motif-like protein
15	9606.ENSP00000263253	0.912	Histone acetyltransferase p300
16	9606.ENSP00000263754	0.909	Histone acetyltransferase KAT2B
17	9606.ENSP00000421180	0.906	Mastermind-like protein 3
18	9606.ENSP00000225916	0.904	Histone acetyltransferase KAT2A
19	9606.ENSP00000414517	0.904	Mastermind-like domain-containing protein 1
20	9606.ENSP00000262367	0.902	CREB-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	1.000	sequence-specific DNA binding
GO:0003690	0.958	double-stranded DNA binding
GO:0008134	0.948	transcription factor binding
GO:0140297	0.942	DNA-binding transcription factor binding
GO:1990837	0.929	sequence-specific double-stranded DNA binding
GO:0001227	0.653	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0042802	0.559	identical protein binding
GO:0046983	0.502	protein dimerization activity
GO:0000976	0.455	transcription cis-regulatory region binding
GO:0000977	0.360	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.353	cis-regulatory region sequence-specific DNA binding
GO:0061629	0.340	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000978	0.325	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0046982	0.319	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0009987	0.996	cellular process
GO:0048856	0.996	anatomical structure development
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0051716	0.992	cellular response to stimulus
GO:0007275	0.992	multicellular organism development
GO:0007154	0.984	cell communication
GO:0007507	0.982	heart development
GO:0023052	0.979	signaling
GO:0007165	0.966	signal transduction
GO:0045892	0.965	negative regulation of DNA-templated transcription
GO:0007219	0.955	Notch signaling pathway
GO:0030154	0.939	cell differentiation
GO:0009653	0.923	anatomical structure morphogenesis
GO:0009888	0.916	tissue development
GO:0006357	0.913	regulation of transcription by RNA polymerase II
GO:0003007	0.906	heart morphogenesis
GO:0048518	0.883	positive regulation of biological process
GO:1905314	0.876	semi-lunar valve development
GO:0003179	0.876	heart valve morphogenesis
GO:0001837	0.847	epithelial to mesenchymal transition
GO:0060317	0.802	cardiac epithelial to mesenchymal transition
GO:0048522	0.798	positive regulation of cellular process
GO:0061311	0.724	cell surface receptor signaling pathway involved in heart development
GO:0010604	0.616	positive regulation of macromolecule metabolic process
GO:0051173	0.605	positive regulation of nitrogen compound metabolic process
GO:0000122	0.596	negative regulation of transcription by RNA polymerase II
GO:0048729	0.571	tissue morphogenesis
GO:0031325	0.553	positive regulation of cellular metabolic process
GO:0065009	0.507	regulation of molecular function
GO:0051239	0.463	regulation of multicellular organismal process
GO:0010557	0.420	positive regulation of macromolecule biosynthetic process
GO:0045935	0.420	positive regulation of nucleobase-containing compound metabolic process
GO:1903508	0.406	positive regulation of nucleic acid-templated transcription
GO:0010646	0.396	regulation of cell communication
GO:0045944	0.395	positive regulation of transcription by RNA polymerase II
GO:0048583	0.392	regulation of response to stimulus
GO:0023051	0.382	regulation of signaling
GO:0048646	0.360	anatomical structure formation involved in morphogenesis
GO:0001944	0.340	vasculature development
GO:0050793	0.320	regulation of developmental process
GO:0042127	0.307	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.933	protein-containing complex
GO:0005737	0.910	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]