StarFunc result for job id Q9UBQ5

User Input

>input (218 residues)
MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAF
FQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQA
LDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWS
ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DBZ5	0.887	0.887	4.857E-29	218	0.986	0.986	Q9DBZ5.pdb.gz	EIF3K_MOUSE Eukaryotic translation initiation factor 3 subunit K OS=Mus musculus OX=10090 GN=Eif3k PE=1 SV=1
2	PDB:6zonK	0.883	0.887	2.946E-25	217	0.991	0.995	6zonK.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
3	AFDB:A0A087WVB9	0.664	0.779	6.291E-22	185	0.839	0.989	A0A087WVB9.pdb.gz	A0A087WVB9_HUMAN Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1
4	AFDB:Q9XUP3	0.833	0.759	4.851E-17	240	0.381	0.346	Q9XUP3.pdb.gz	EIF3K_CAEEL Eukaryotic translation initiation factor 3 subunit K OS=Caenorhabditis elegans OX=6239 GN=eif-3.K PE=2 SV=1
5	AFDB:Q9SZA3	0.798	0.772	1.082E-13	226	0.317	0.305	Q9SZA3.pdb.gz	EIF3K_ARATH Eukaryotic translation initiation factor 3 subunit K OS=Arabidopsis thaliana OX=3702 GN=TIF3K1 PE=2 SV=1
6	AFDB:Q381P3	0.676	0.715	1.112E-8	205	0.206	0.220	Q381P3.pdb.gz	Q381P3_TRYB2 CSN8/PSMD8/EIF3K domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7070 PE=4 SV=1
7	AFDB:Q4Q557	0.678	0.638	5.146E-8	233	0.211	0.197	Q4Q557.pdb.gz	Q4Q557_LEIMA CSN8/PSMD8/EIF3K domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_32_2180 PE=4 SV=1
8	AFDB:Q9V436	0.584	0.498	7.137E-6	264	0.188	0.155	Q9V436.pdb.gz	Q9V436_DROME 26S proteasome non-ATPase regulatory subunit 8 OS=Drosophila melanogaster OX=7227 GN=Rpn12 PE=1 SV=1
9	AFDB:Q9SGW3	0.584	0.494	2.479E-5	267	0.165	0.135	Q9SGW3.pdb.gz	PSD8A_ARATH 26S proteasome non-ATPase regulatory subunit 8 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN12A PE=1 SV=1
10	AFDB:Q9FHY0	0.482	0.455	4.846E-5	233	0.133	0.124	Q9FHY0.pdb.gz	PSD8B_ARATH Putative 26S proteasome non-ATPase regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPN12B PE=5 SV=2
11	PDB:4cr2T	0.537	0.451	8.989E-5	272	0.156	0.125	4cr2T.pdb.gz	Deep Classification of a Large Cryo-Em Dataset Defines the Conformational Landscape of the 26S Proteasome.
12	AFDB:P43255	0.437	0.475	9.474E-5	197	0.156	0.173	P43255.pdb.gz	CSN8_ARATH COP9 signalosome complex subunit 8 OS=Arabidopsis thaliana OX=3702 GN=CSN8 PE=1 SV=1
13	PDB:4d10H	0.513	0.620	2.704E-4	173	0.110	0.139	4d10H.pdb.gz	Crystal Structure of the Human Cop9 Signalosome
14	PDB:5l4kT	0.468	0.395	7.018E-3	272	0.165	0.132	5l4kT.pdb.gz
15	PDB:5mpbP	0.486	0.277	1.372E-2	440	0.174	0.086	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
16	PDB:5l3tA	0.503	0.398	1.584E-2	294	0.110	0.082	5l3tA.pdb.gz	The Sac3 TPR-like region in the Saccharomyces cerevisiae TREX-2 complex is more extensive but independent of the CID region.
17	PDB:5gjqP	0.472	0.280	2.557E-2	413	0.124	0.065	5gjqP.pdb.gz	An atomic structure of the human 26S proteasome.
18	PDB:6fyxo	0.451	0.219	2.814E-2	529	0.174	0.072	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:6r7nB	0.567	0.309	2.814E-2	443	0.124	0.061	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
20	PDB:6j2cS	0.280	0.160	3.097E-2	475	0.142	0.065	6j2cS.pdb.gz	Structural Snapshots of 26S Proteasome Reveal Tetraubiquitin-Induced Conformations.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBQ5	7.36e-166	457	218	1.000	1.000	EIF3K_HUMAN Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1
2	Q9DBZ5	1.02e-164	454	218	0.986	0.986	EIF3K_MOUSE Eukaryotic translation initiation factor 3 subunit K OS=Mus musculus OX=10090 GN=Eif3k PE=1 SV=1
3	A0A087WVB9	6.34e-133	373	185	0.849	1.000	A0A087WVB9_HUMAN Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1
4	K7EK53	4.94e-95	275	131	0.601	1.000	K7EK53_HUMAN Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1
5	B4DQ48	1.53e-88	258	124	0.560	0.984	B4DQ48_HUMAN Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1
6	Q9XUP3	2.01e-52	171	240	0.381	0.346	EIF3K_CAEEL Eukaryotic translation initiation factor 3 subunit K OS=Caenorhabditis elegans OX=6239 GN=eif-3.K PE=2 SV=1
7	Q9SZA3	2.10e-35	126	226	0.317	0.305	EIF3K_ARATH Eukaryotic translation initiation factor 3 subunit K OS=Arabidopsis thaliana OX=3702 GN=TIF3K1 PE=2 SV=1
8	Q381P3	1.34e-05	46.6	205	0.220	0.234	Q381P3_TRYB2 CSN8/PSMD8/EIF3K domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7070 PE=4 SV=1
9	Q4Q557	0.16	34.7	233	0.133	0.124	Q4Q557_LEIMA CSN8/PSMD8/EIF3K domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_32_2180 PE=4 SV=1
10	A5K736	0.52	33.9	2652	0.128	0.011	A5K736_PLAVS Reticulocyte binding protein 2, putative OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=PVX_094255 PE=1 SV=1
11	P48037	3.4	31.2	673	0.119	0.039	ANXA6_RAT Annexin A6 OS=Rattus norvegicus OX=10116 GN=Anxa6 PE=1 SV=2
12	P14824	3.6	31.2	673	0.119	0.039	ANXA6_MOUSE Annexin A6 OS=Mus musculus OX=10090 GN=Anxa6 PE=1 SV=3
13	M3VH45	4.0	30.8	673	0.119	0.039	M3VH45_PIG Annexin OS=Sus scrofa OX=9823 GN=ANXA6 PE=2 SV=1
14	P08133	4.4	30.8	673	0.119	0.039	ANXA6_HUMAN Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6 PE=1 SV=3
15	Q88RA3	7.1	29.6	277	0.083	0.065	TAUD_PSEPK Alpha-ketoglutarate-dependent taurine dioxygenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=tauD PE=1 SV=1
16	Q8WRU4	9.3	29.6	399	0.110	0.060	Q8WRU4_9TRYP Proteasome regulatory non-ATP-ase subunit 7 OS=Trypanosoma brucei OX=5691 GN=Rpn7 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10075 CSN8_PSD8_EIF3K	1.5e-31	120.8	CSN8/PSMD8/EIF3K family
2	PF13518 HTH_28	1.8e+02	13.6	Helix-turn-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010384030.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010352237.1	0.999	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
2	61622.XP_010356642.1	0.999	Eukaryotic translation initiation factor 3 subunit M
3	61622.XP_010369113.1	0.999	Eukaryotic translation initiation factor 3 subunit E isoform X1
4	61622.XP_010372090.1	0.999	RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre- initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents p [...]
5	61622.XP_010385181.1	0.999	Eukaryotic translation initiation factor 3 subunit H isoform X1
6	61622.XP_010387475.1	0.999	mRNA cap-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, a complex required for several steps in the initiation of protein synthesis of a specialized repertoire of mRNAs. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl- tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribo [...]
7	61622.XP_010387520.1	0.999	Eukaryotic translation initiation factor 3 subunit L
8	61622.XP_010364964.1	0.998	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome
9	61622.XP_010374272.1	0.998	Eukaryotic translation initiation factor 3 subunit A
10	61622.XP_010383530.1	0.998	Eukaryotic translation initiation factor 3 subunit J
11	61622.XP_010386983.1	0.998	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
12	61622.XP_010355924.1	0.994	Eukaryotic translation initiation factor 3 subunit F-like
13	61622.XP_010359381.1	0.994	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
14	61622.XP_010371467.1	0.994	Eukaryotic translation initiation factor 3 subunit F
15	61622.XP_010362242.1	0.986	Belongs to the eukaryotic ribosomal protein eS30 family.
16	61622.XP_010379065.1	0.979	40S ribosomal protein S19
17	61622.XP_010380060.1	0.979	Ribosomal protein S19
18	61622.XP_010378210.1	0.978	Ribosomal protein S28
19	61622.XP_010373201.1	0.977	Belongs to the universal ribosomal protein uS19 family.
20	61622.XP_010356159.1	0.976	Belongs to the universal ribosomal protein uS13 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003743	1.000	translation initiation factor activity
GO:0005515	0.996	protein binding
GO:0003723	0.364	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006413	0.996	translational initiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005852	0.986	eukaryotic translation initiation factor 3 complex
GO:0005829	0.974	cytosol
GO:0016020	0.943	membrane
GO:0031981	0.623	nuclear lumen
GO:0043232	0.588	intracellular non-membrane-bounded organelle
GO:0005654	0.311	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]