StarFunc result for job id Q9UBQ6

User Input

>input (330 residues)
MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGK
STMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIP
VIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPR
KHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDT
QNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKL
VNIYDSMPLRYSNIMISQFGFPYANYKRKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBQ6	1.000	1.000	4.194E-71	330	1.000	1.000	Q9UBQ6.pdb.gz	EXTL2_HUMAN Exostosin-like 2 OS=Homo sapiens OX=9606 GN=EXTL2 PE=1 SV=1
2	AFDB:Q9ES89	0.894	0.894	1.783E-63	330	0.870	0.870	Q9ES89.pdb.gz	EXTL2_MOUSE Exostosin-like 2 OS=Mus musculus OX=10090 GN=Extl2 PE=1 SV=1
3	AFDB:Q9LY62	0.684	0.676	1.068E-26	334	0.261	0.257	Q9LY62.pdb.gz	GMT1_ARATH Glycosylinositol phosphorylceramide mannosyl transferase 1 OS=Arabidopsis thaliana OX=3702 GN=GMT1 PE=1 SV=1
4	AFDB:O77783	0.693	0.324	8.685E-26	718	0.261	0.120	O77783.pdb.gz	EXT2_BOVIN Exostosin-2 OS=Bos taurus OX=9913 GN=EXT2 PE=1 SV=1
5	AFDB:F1QUC2	0.708	0.332	2.328E-25	719	0.267	0.122	F1QUC2.pdb.gz
6	AFDB:Q9Y169	0.705	0.333	3.729E-24	717	0.252	0.116	Q9Y169.pdb.gz	EXT2_DROME Exostosin-2 OS=Drosophila melanogaster OX=7227 GN=sotv PE=1 SV=1
7	PDB:7sckB	0.672	0.378	1.882E-23	598	0.252	0.139	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
8	AFDB:O43909	0.676	0.250	1.330E-22	919	0.245	0.088	O43909.pdb.gz	EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
9	AFDB:Q5U7D2	0.671	0.248	2.317E-22	917	0.236	0.085	Q5U7D2.pdb.gz	Q5U7D2_DANRE Exostoses (Multiple)-like 3 OS=Danio rerio OX=7955 GN=im:7141548 PE=1 SV=1
10	AFDB:Q9XZ08	0.670	0.236	3.567E-22	972	0.236	0.080	Q9XZ08.pdb.gz	EXT3_DROME Exostosin-3 OS=Drosophila melanogaster OX=7227 GN=botv PE=1 SV=1
11	AFDB:G3V901	0.685	0.313	4.291E-22	746	0.224	0.099	G3V901.pdb.gz	G3V901_RAT Exostosin glycosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ext1 PE=3 SV=1
12	PDB:7au2A	0.658	0.324	1.497E-21	686	0.248	0.120	7au2A.pdb.gz
13	PDB:7sckA	0.654	0.345	3.136E-21	642	0.224	0.115	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
14	PDB:7schA	0.596	0.330	2.821E-19	603	0.212	0.116	7schA.pdb.gz
15	PDB:7scjA	0.474	0.282	2.322E-13	563	0.182	0.107	7scjA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
16	PDB:6pxuB	0.382	0.250	1.869E-6	532	0.103	0.064	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
17	PDB:6h0bB	0.368	0.249	2.114E-6	521	0.085	0.054	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
18	PDB:2d7iA	0.390	0.256	6.819E-6	536	0.064	0.039	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
19	PDB:4d0tA	0.496	0.349	1.519E-5	496	0.094	0.062	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
20	PDB:4d11C	0.379	0.296	4.900E-5	436	0.073	0.055	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JEG3	0.0	533	266	0.776	0.962	C9JEG3_HUMAN Exostosin like glycosyltransferase 2 (Fragment) OS=Homo sapiens OX=9606 GN=EXTL2 PE=1 SV=1
2	Q9ES89	0.0	581	330	0.870	0.870	EXTL2_MOUSE Exostosin-like 2 OS=Mus musculus OX=10090 GN=Extl2 PE=1 SV=1
3	Q9UBQ6	0.0	690	330	1.000	1.000	EXTL2_HUMAN Exostosin-like 2 OS=Homo sapiens OX=9606 GN=EXTL2 PE=1 SV=1
4	Q5U7A7	1.85e-37	144	719	0.242	0.111	Q5U7A7_DANRE Exostosin-2 OS=Danio rerio OX=7955 GN=fc14g07 PE=1 SV=1
5	Q9LY62	1.56e-36	136	334	0.288	0.284	GMT1_ARATH Glycosylinositol phosphorylceramide mannosyl transferase 1 OS=Arabidopsis thaliana OX=3702 GN=GMT1 PE=1 SV=1
6	P70428	2.15e-36	140	718	0.248	0.114	EXT2_MOUSE Exostosin-2 OS=Mus musculus OX=10090 GN=Ext2 PE=1 SV=2
7	O77783	3.84e-36	140	718	0.248	0.114	EXT2_BOVIN Exostosin-2 OS=Bos taurus OX=9913 GN=EXT2 PE=1 SV=1
8	Q93063	3.99e-36	140	718	0.248	0.114	EXT2_HUMAN Exostosin-2 OS=Homo sapiens OX=9606 GN=EXT2 PE=1 SV=1
9	Q9Y169	6.58e-36	139	717	0.264	0.121	EXT2_DROME Exostosin-2 OS=Drosophila melanogaster OX=7227 GN=sotv PE=1 SV=1
10	O43909	1.20e-35	139	919	0.258	0.092	EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
11	Q9WVL6	1.24e-35	139	918	0.258	0.093	EXTL3_MOUSE Exostosin-like 3 OS=Mus musculus OX=10090 GN=Extl3 PE=1 SV=2
12	Q9JMA8	1.27e-35	139	919	0.258	0.092	Q9JMA8_RAT Exostosin-like glycosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Extl3 PE=3 SV=1
13	Q5U7D2	9.10e-35	136	917	0.255	0.092	Q5U7D2_DANRE Exostoses (Multiple)-like 3 OS=Danio rerio OX=7955 GN=im:7141548 PE=1 SV=1
14	O01705	1.68e-32	129	814	0.242	0.098	EXT2_CAEEL Exostosin-2 homolog OS=Caenorhabditis elegans OX=6239 GN=rib-2 PE=1 SV=2
15	Q9XZ08	4.77e-28	117	972	0.245	0.083	EXT3_DROME Exostosin-3 OS=Drosophila melanogaster OX=7227 GN=botv PE=1 SV=1
16	Q84WB7	1.84e-26	112	765	0.218	0.094	GINT1_ARATH Glucosamine inositolphosphorylceramide transferase 1 OS=Arabidopsis thaliana OX=3702 GN=GINT1 PE=1 SV=1
17	Q3B8R0	2.68e-23	102	557	0.221	0.131	Q3B8R0_RAT Ext1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ext1 PE=2 SV=1
18	G3V901	5.25e-23	102	746	0.221	0.098	G3V901_RAT Exostosin glycosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ext1 PE=3 SV=1
19	P97464	5.25e-23	102	746	0.221	0.098	EXT1_MOUSE Exostosin-1 OS=Mus musculus OX=10090 GN=Ext1 PE=1 SV=1
20	Q16394	8.31e-23	101	746	0.218	0.097	EXT1_HUMAN Exostosin-1 OS=Homo sapiens OX=9606 GN=EXT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	36	15.2	Fringe-like
2	PF13641 Glyco_tranf_2_3	42	15.4	Glycosyltransferase like family 2
3	PF09258 Glyco_transf_64	4.1e-84	293.3	Glycosyl transferase family 64 domain
4	PF06305 LapA_dom	21	16.3	Lipopolysaccharide assembly protein A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359132

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216037	0.900	X-box-binding protein 1
2	9606.ENSP00000220562	0.870	Exostosin-like 3
3	9606.ENSP00000017003	0.762	Xylosyltransferase 2
4	9606.ENSP00000261381	0.727	Xylosyltransferase 1
5	9606.ENSP00000411528	0.687	Gap junction gamma-1 protein
6	9606.ENSP00000263733	0.672	Glycosaminoglycan xylosylkinase
7	9606.ENSP00000029410	0.661	Beta-1,4-galactosyltransferase 7
8	9606.ENSP00000368496	0.635	Beta-1,3-galactosyltransferase 6
9	9606.ENSP00000261858	0.628	D-glucuronyl C5-epimerase
10	9606.ENSP00000363590	0.619	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
11	9606.ENSP00000359579	0.610	Heparan sulfate 2-O-sulfotransferase 1
12	9606.ENSP00000359581	0.606	Heparan sulfate 2-O-sulfotransferase 1
13	9606.ENSP00000421275	0.591	Sodium/bile acid cotransporter 7
14	9606.ENSP00000265471	0.590	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
15	9606.ENSP00000243776	0.586	Chondroitin sulfate synthase 2
16	9606.ENSP00000296499	0.582	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3
17	9606.ENSP00000310657	0.578	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
18	9606.ENSP00000264363	0.573	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4
19	9606.ENSP00000261797	0.565	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
20	9606.ENSP00000307297	0.559	Carbohydrate sulfotransferase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008376	1.000	acetylgalactosaminyltransferase activity
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0005515	0.997	protein binding
GO:0043167	0.913	ion binding
GO:0035248	0.851	alpha-1,4-N-acetylgalactosaminyltransferase activity
GO:0046872	0.609	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009225	0.996	nucleotide-sugar metabolic process
GO:0006040	0.989	amino sugar metabolic process
GO:1901071	0.880	glucosamine-containing compound metabolic process
GO:0006793	0.733	phosphorus metabolic process
GO:1901564	0.490	organonitrogen compound metabolic process
GO:0043170	0.448	macromolecule metabolic process
GO:1901137	0.424	carbohydrate derivative biosynthetic process
GO:0044249	0.326	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0031090	0.999	organelle membrane
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.997	nucleus
GO:0005829	0.994	cytosol
GO:0005654	0.992	nucleoplasm
GO:0005783	0.961	endoplasmic reticulum
GO:0005794	0.932	Golgi apparatus
GO:0098588	0.929	bounding membrane of organelle
GO:0005789	0.925	endoplasmic reticulum membrane
GO:0000139	0.840	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]