StarFunc result for job id Q9UBR1

User Input

>input (384 residues)
MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFE
AAEEQLRRPRIVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEA
WTMPFAFCTREKLPWTEFAESAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNT
AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPL
NWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANHCFTCAINRVGTEHFPNEFTS
GDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTG
RYEMYARELAEAVKSNYSPTIVKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBR1	1.000	1.000	4.393E-85	384	1.000	1.000	Q9UBR1.pdb.gz	BUP1_HUMAN Beta-ureidopropionase OS=Homo sapiens OX=9606 GN=UPB1 PE=1 SV=1
2	AFDB:Q03248	0.998	0.975	8.741E-79	393	0.846	0.827	Q03248.pdb.gz	BUP1_RAT Beta-ureidopropionase OS=Rattus norvegicus OX=10116 GN=Upb1 PE=1 SV=1
3	AFDB:Q19437	0.989	0.982	8.019E-67	387	0.620	0.615	Q19437.pdb.gz	Q19437_CAEEL CN hydrolase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=upb-1 PE=1 SV=1
4	AFDB:Q9VI04	0.992	0.987	9.014E-67	386	0.641	0.637	Q9VI04.pdb.gz	Q9VI04_DROME Beta-alanine synthase OS=Drosophila melanogaster OX=7227 GN=pyd3 PE=1 SV=2
5	PDB:2vhhC	0.983	0.988	3.950E-65	382	0.635	0.639	2vhhC.pdb.gz
6	PDB:6ftqA	0.839	0.968	8.958E-65	332	0.854	0.988	6ftqA.pdb.gz
7	AFDB:Q964D8	0.987	0.969	1.156E-64	391	0.562	0.552	Q964D8.pdb.gz	BUP1_DICDI Beta-ureidopropionase OS=Dictyostelium discoideum OX=44689 GN=pyd3 PE=1 SV=1
8	AFDB:Q8H183	0.973	0.916	2.075E-64	408	0.596	0.561	Q8H183.pdb.gz	BUP1_ARATH Beta-ureidopropionase OS=Arabidopsis thaliana OX=3702 GN=PYD3 PE=1 SV=1
9	PDB:2vhiA	0.892	0.984	1.001E-53	348	0.560	0.618	2vhiA.pdb.gz
10	AFDB:Q8VYF5	0.700	0.889	1.828E-26	299	0.214	0.274	Q8VYF5.pdb.gz	NILP1_ARATH N-carbamoylputrescine amidase OS=Arabidopsis thaliana OX=3702 GN=CPA PE=1 SV=2
11	AFDB:Q9I6J8	0.670	0.873	3.210E-25	292	0.221	0.291	Q9I6J8.pdb.gz	Q9I6J8_PSEAE N-carbamoylputrescine amidohydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aguB PE=3 SV=1
12	AFDB:O59829	0.638	0.891	5.848E-23	272	0.161	0.228	O59829.pdb.gz	YCU9_SCHPO Probable nitrilase C965.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.09 PE=3 SV=1
13	AFDB:Q3LRV4	0.625	0.682	1.912E-20	350	0.193	0.211	Q3LRV4.pdb.gz	NRL4B_LUPAN Bifunctional nitrilase/nitrile hydratase NIT4B OS=Lupinus angustifolius OX=3871 GN=NIT4B PE=1 SV=1
14	PDB:2w1vA	0.621	0.859	1.367E-19	274	0.154	0.215	2w1vA.pdb.gz
15	PDB:1f89A	0.596	0.830	2.545E-18	271	0.161	0.229	1f89A.pdb.gz
16	PDB:2uxyA	0.599	0.671	5.134E-18	341	0.148	0.167	2uxyA.pdb.gz
17	PDB:4hg3A	0.608	0.753	1.358E-16	304	0.154	0.194	4hg3A.pdb.gz	Structures of enzyme-intermediate complexes of yeast Nit2: insights into its catalytic mechanism and different substrate specificity compared with mammalian Nit2
18	PDB:1emsA	0.609	0.570	3.590E-15	412	0.143	0.133	1emsA.pdb.gz
19	PDB:6i00A	0.561	0.732	7.678E-15	289	0.172	0.228	6i00A.pdb.gz
20	PDB:3seqA	0.537	0.327	2.420E-13	661	0.141	0.082	3seqA.pdb.gz	Regulation of the intersubunit ammonia tunnel in Mycobacterium tuberculosis glutamine-dependent NAD+ synthetase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03248	0.0	697	393	0.846	0.827	BUP1_RAT Beta-ureidopropionase OS=Rattus norvegicus OX=10116 GN=Upb1 PE=1 SV=1
2	Q19437	0.0	521	387	0.620	0.615	Q19437_CAEEL CN hydrolase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=upb-1 PE=1 SV=1
3	Q8VC97	0.0	698	393	0.857	0.837	BUP1_MOUSE Beta-ureidopropionase OS=Mus musculus OX=10090 GN=Upb1 PE=1 SV=1
4	Q9UBR1	0.0	805	384	1.000	1.000	BUP1_HUMAN Beta-ureidopropionase OS=Homo sapiens OX=9606 GN=UPB1 PE=1 SV=1
5	Q9VI04	0.0	531	386	0.641	0.637	Q9VI04_DROME Beta-alanine synthase OS=Drosophila melanogaster OX=7227 GN=pyd3 PE=1 SV=2
6	Q964D8	8.06e-173	489	391	0.560	0.550	BUP1_DICDI Beta-ureidopropionase OS=Dictyostelium discoideum OX=44689 GN=pyd3 PE=1 SV=1
7	Q8H183	4.69e-168	477	408	0.596	0.561	BUP1_ARATH Beta-ureidopropionase OS=Arabidopsis thaliana OX=3702 GN=PYD3 PE=1 SV=1
8	Q9I6J8	5.35e-28	113	292	0.219	0.288	Q9I6J8_PSEAE N-carbamoylputrescine amidohydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aguB PE=3 SV=1
9	Q8VYF5	4.13e-27	111	299	0.227	0.291	NILP1_ARATH N-carbamoylputrescine amidase OS=Arabidopsis thaliana OX=3702 GN=CPA PE=1 SV=2
10	O59829	3.71e-14	74.3	272	0.143	0.202	YCU9_SCHPO Probable nitrilase C965.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.09 PE=3 SV=1
11	Q8VDK1	1.79e-12	69.7	323	0.141	0.167	NIT1_MOUSE Deaminated glutathione amidase OS=Mus musculus OX=10090 GN=Nit1 PE=1 SV=2
12	Q86X76	6.25e-11	65.5	327	0.148	0.174	NIT1_HUMAN Deaminated glutathione amidase OS=Homo sapiens OX=9606 GN=NIT1 PE=1 SV=2
13	Q94JV5	1.14e-10	64.3	307	0.174	0.218	NILP2_ARATH Deaminated glutathione amidase, chloroplastic/cytosolic OS=Arabidopsis thaliana OX=3702 GN=NLP2 PE=1 SV=1
14	Q5S260	3.88e-10	62.8	304	0.185	0.234	DCAS_ENSAD N-carbamoyl-D-amino acid hydrolase OS=Ensifer adhaerens OX=106592 PE=1 SV=1
15	Q59WF0	5.90e-10	62.0	301	0.198	0.252	Q59WF0_CANAL Hydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NIT3 PE=4 SV=1
16	P49954	6.59e-09	58.9	291	0.104	0.137	NIT3_YEAST Omega-amidase NIT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIT3 PE=1 SV=1
17	Q3LRV4	7.43e-09	58.9	350	0.182	0.200	NRL4B_LUPAN Bifunctional nitrilase/nitrile hydratase NIT4B OS=Lupinus angustifolius OX=3871 GN=NIT4B PE=1 SV=1
18	Q8RUF8	2.71e-08	57.4	369	0.180	0.187	NILP3_ARATH Omega-amidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NLP3 PE=1 SV=1
19	Q5QGZ8	1.04e-07	55.5	349	0.180	0.198	NRL4A_LUPAN Bifunctional nitrilase/nitrile hydratase NIT4A OS=Lupinus angustifolius OX=3871 GN=NIT4A PE=1 SV=1
20	Q10166	6.49e-07	53.1	322	0.133	0.158	YAUB_SCHPO Hydrolase C26A3.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26A3.11 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00795 CN_hydrolase	6.1e-56	201.2	Carbon-nitrogen hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276651	0.990	Dihydropyrimidinase
2	9606.ENSP00000359211	0.986	Dihydropyrimidine dehydrogenase [NADP(+)]
3	9606.ENSP00000379845	0.941	4-aminobutyrate aminotransferase, mitochondrial
4	9606.ENSP00000231420	0.930	Alanine--glyoxylate aminotransferase 2, mitochondrial
5	9606.ENSP00000346827	0.928	4-trimethylaminobutyraldehyde dehydrogenase
6	9606.ENSP00000261733	0.924	Aldehyde dehydrogenase, mitochondrial
7	9606.ENSP00000366927	0.919	Aldehyde dehydrogenase X, mitochondrial
8	9606.ENSP00000365437	0.915	Glutamate decarboxylase 2
9	9606.ENSP00000255084	0.912	Aldehyde dehydrogenase family 3 member B2
10	9606.ENSP00000345774	0.912	Fatty aldehyde dehydrogenase
11	9606.ENSP00000351682	0.912	Carnosine dipeptidase 1
12	9606.ENSP00000411821	0.912	Aldehyde dehydrogenase, dimeric NADP-preferring
13	9606.ENSP00000473990	0.912	Aldehyde dehydrogenase family 3 member B1
14	9606.ENSP00000282538	0.910	Acidic amino acid decarboxylase GADL1
15	9606.ENSP00000325548	0.910	Cytosolic non-specific dipeptidase
16	9606.ENSP00000350928	0.908	Glutamate decarboxylase 1
17	9606.ENSP00000387123	0.906	Alpha-aminoadipic semialdehyde dehydrogenase
18	9606.ENSP00000389009	0.904	Carnosine synthase 1
19	9606.ENSP00000479130	0.903	Acyl-CoA synthetase family member 3, mitochondrial
20	9606.ENSP00000363832	0.875	Aldehyde oxidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003837	1.000	beta-ureidopropionase activity
GO:0046983	0.999	protein dimerization activity
GO:0042802	0.974	identical protein binding
GO:0042803	0.898	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044281	0.990	small molecule metabolic process
GO:1901564	0.989	organonitrogen compound metabolic process
GO:0044248	0.979	cellular catabolic process
GO:1901361	0.945	organic cyclic compound catabolic process
GO:0044270	0.943	cellular nitrogen compound catabolic process
GO:0046700	0.939	heterocycle catabolic process
GO:0055086	0.914	nucleobase-containing small molecule metabolic process
GO:0072529	0.906	pyrimidine-containing compound catabolic process
GO:0006520	0.888	amino acid metabolic process
GO:0009058	0.868	biosynthetic process
GO:0044249	0.864	cellular biosynthetic process
GO:1901576	0.849	organic substance biosynthetic process
GO:1901566	0.841	organonitrogen compound biosynthetic process
GO:0044283	0.663	small molecule biosynthetic process
GO:0016053	0.462	organic acid biosynthetic process
GO:0046394	0.434	carboxylic acid biosynthetic process
GO:0008652	0.301	amino acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.994	membrane-bounded organelle
GO:0005576	0.933	extracellular region
GO:0031982	0.888	vesicle
GO:0043230	0.873	extracellular organelle
GO:0070062	0.856	extracellular exosome
GO:0043231	0.796	intracellular membrane-bounded organelle
GO:0070013	0.357	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11184	1.000	3-(carbamoylamino)propanoate + 2 H(+) + H2O = beta-alanine + CO2 + NH4(+)
EC:3.5.1.6	1.000	beta-ureidopropionase.

[back to server]