StarFunc result for job id Q9UBR2

User Input

>input (303 residues)
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPA
DLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV
QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECH
AIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN
HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD
PIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBR2	1.000	1.000	5.101E-69	303	1.000	1.000	Q9UBR2.pdb.gz	CATZ_HUMAN Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1
2	AFDB:Q9R1T3	0.922	0.913	8.964E-60	306	0.825	0.817	Q9R1T3.pdb.gz	CATZ_RAT Cathepsin Z OS=Rattus norvegicus OX=10116 GN=Ctsz PE=1 SV=2
3	PDB:1deuA	0.901	0.993	2.041E-58	275	0.904	0.996	1deuA.pdb.gz
4	AFDB:F1RDQ9	0.948	0.954	4.615E-53	301	0.634	0.638	F1RDQ9.pdb.gz
5	AFDB:G5EGP8	0.858	0.850	1.999E-43	306	0.525	0.520	G5EGP8.pdb.gz	CATZ1_CAEEL Cathepsin Z-1 OS=Caenorhabditis elegans OX=6239 GN=cpz-1 PE=1 SV=1
6	AFDB:Q6PN98	0.864	0.856	1.369E-42	306	0.538	0.533	Q6PN98.pdb.gz	CATZ_ONCVO Cathepsin Z OS=Onchocerca volvulus OX=6282 GN=cpz PE=2 SV=1
7	PDB:1jqpA	0.663	0.579	2.520E-22	348	0.257	0.224	1jqpA.pdb.gz
8	AFDB:Q3ZCJ8	0.673	0.446	7.448E-22	463	0.261	0.171	Q3ZCJ8.pdb.gz	CATC_BOVIN Dipeptidyl peptidase 1 OS=Bos taurus OX=9913 GN=CTSC PE=2 SV=1
9	PDB:3pdfA	0.671	0.581	7.899E-22	351	0.254	0.219	3pdfA.pdb.gz	Discovery of novel cyanamide-based inhibitors of cathepsin C.
10	AFDB:P53634	0.678	0.449	8.920E-22	463	0.267	0.175	P53634.pdb.gz	CATC_HUMAN Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2
11	AFDB:P80067	0.677	0.450	1.443E-21	462	0.271	0.177	P80067.pdb.gz	CATC_RAT Dipeptidyl peptidase 1 OS=Rattus norvegicus OX=10116 GN=Ctsc PE=1 SV=3
12	AFDB:Q7JWQ7	0.688	0.494	2.294E-20	431	0.264	0.186	Q7JWQ7.pdb.gz	Q7JWQ7_DROME RE01730p OS=Drosophila melanogaster OX=7227 GN=Swim PE=1 SV=1
13	AFDB:D6XHE1	0.681	0.613	5.013E-20	340	0.215	0.191	D6XHE1.pdb.gz	D6XHE1_TRYB2 Cysteine peptidase C (CPC) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.230 PE=1 SV=1
14	PDB:2c0yA	0.627	0.618	2.083E-18	308	0.228	0.224	2c0yA.pdb.gz
15	PDB:1mirA	0.640	0.621	4.286E-18	313	0.234	0.227	1mirA.pdb.gz
16	PDB:7e3fA	0.622	0.613	5.451E-18	308	0.224	0.221	7e3fA.pdb.gz
17	PDB:2o6xA	0.679	0.672	1.609E-17	306	0.211	0.209	2o6xA.pdb.gz
18	PDB:1cs8A	0.612	0.588	2.174E-17	316	0.218	0.209	1cs8A.pdb.gz
19	PDB:2pnsA	0.612	0.876	1.102E-16	208	0.208	0.303	2pnsA.pdb.gz
20	PDB:7pckA	0.635	0.614	1.320E-16	314	0.218	0.210	7pckA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9R1T3	0.0	519	306	0.805	0.797	CATZ_RAT Cathepsin Z OS=Rattus norvegicus OX=10116 GN=Ctsz PE=1 SV=2
2	Q9UBR2	0.0	630	303	1.000	1.000	CATZ_HUMAN Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1
3	Q9WUU7	0.0	515	306	0.795	0.788	CATZ_MOUSE Cathepsin Z OS=Mus musculus OX=10090 GN=Ctsz PE=1 SV=1
4	Q5XJD4	1.79e-145	412	301	0.634	0.638	Q5XJD4_DANRE cathepsin X OS=Danio rerio OX=7955 GN=zgc:103420 PE=1 SV=1
5	G5EGP8	1.66e-107	317	306	0.538	0.533	CATZ1_CAEEL Cathepsin Z-1 OS=Caenorhabditis elegans OX=6239 GN=cpz-1 PE=1 SV=1
6	Q6PN98	2.23e-106	313	306	0.512	0.507	CATZ_ONCVO Cathepsin Z OS=Onchocerca volvulus OX=6282 GN=cpz PE=2 SV=1
7	P97821	1.05e-28	116	462	0.261	0.171	CATC_MOUSE Dipeptidyl peptidase 1 OS=Mus musculus OX=10090 GN=Ctsc PE=1 SV=1
8	P53634	7.27e-28	114	463	0.251	0.164	CATC_HUMAN Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2
9	Q3ZCJ8	4.79e-27	112	463	0.248	0.162	CATC_BOVIN Dipeptidyl peptidase 1 OS=Bos taurus OX=9913 GN=CTSC PE=2 SV=1
10	P80067	1.60e-26	110	462	0.251	0.165	CATC_RAT Dipeptidyl peptidase 1 OS=Rattus norvegicus OX=10116 GN=Ctsc PE=1 SV=3
11	Q95S79	3.07e-24	103	430	0.211	0.149	Q95S79_DROME GM06507p OS=Drosophila melanogaster OX=7227 GN=Swim PE=2 SV=1
12	Q95029	7.92e-24	101	371	0.281	0.229	CATL_DROME Cathepsin L OS=Drosophila melanogaster OX=7227 GN=Cp1 PE=2 SV=2
13	Q7JWQ7	1.32e-23	102	431	0.218	0.153	Q7JWQ7_DROME RE01730p OS=Drosophila melanogaster OX=7227 GN=Swim PE=1 SV=1
14	Q93VC9	2.97e-23	100	362	0.234	0.196	CATB2_ARATH Cathepsin B-like protease 2 OS=Arabidopsis thaliana OX=3702 GN=CATHB2 PE=2 SV=1
15	P25774	5.38e-23	99.0	331	0.248	0.227	CATS_HUMAN Cathepsin S OS=Homo sapiens OX=9606 GN=CTSS PE=1 SV=3
16	P25326	1.17e-22	97.8	331	0.271	0.248	CATS_BOVIN Cathepsin S OS=Bos taurus OX=9913 GN=CTSS PE=1 SV=2
17	Q7F3A8	1.56e-22	98.2	371	0.290	0.237	REP1_ORYSJ Cysteine endopeptidase Rep1 OS=Oryza sativa subsp. japonica OX=39947 GN=REP1 PE=1 SV=1
18	P43510	2.23e-22	97.8	379	0.248	0.198	CPR6_CAEEL Cathepsin B-like cysteine proteinase 6 OS=Caenorhabditis elegans OX=6239 GN=cpr-6 PE=1 SV=1
19	Q7K5N8	3.35e-22	97.4	390	0.244	0.190	Q7K5N8_DROME GH01592p OS=Drosophila melanogaster OX=7227 GN=BEST:GH19547 PE=1 SV=1
20	A1ZAU4	5.14e-22	97.4	420	0.244	0.176	A1ZAU4_DROME RH39096p OS=Drosophila melanogaster OX=7227 GN=BEST:GH19547 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00112 Peptidase_C1	2.4e-47	173.4	Papain family cysteine protease
2	PF03051 Peptidase_C1_2	8.5e+02	10.1	Peptidase C1-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217131

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258145	0.930	N-acetylglucosamine-6-sulfatase
2	9606.ENSP00000251047	0.921	Protein ERGIC-53
3	9606.ENSP00000369081	0.917	Thioredoxin domain-containing protein 5
4	9606.ENSP00000432083	0.917	Heat shock cognate 71 kDa protein
5	9606.ENSP00000222219	0.916	Deoxyribonuclease-2-alpha
6	9606.ENSP00000355627	0.909	Angiotensinogen
7	9606.ENSP00000259400	0.902	Syntaxin-17
8	9606.ENSP00000222547	0.900	BET1 homolog
9	9606.ENSP00000360108	0.900	Putative tyrosine-protein phosphatase auxilin
10	9606.ENSP00000390783	0.900	Sec1 family domain-containing protein 1
11	9606.ENSP00000386651	0.804	Multiple coagulation factor deficiency protein 2
12	9606.ENSP00000243911	0.770	Melanocortin receptor 3
13	9606.ENSP00000243997	0.766	ATP synthase subunit epsilon, mitochondrial
14	9606.ENSP00000366280	0.760	VIP36-like protein
15	9606.ENSP00000236671	0.759	Cathepsin D
16	9606.ENSP00000303366	0.756	Vesicular integral-membrane protein VIP36
17	9606.ENSP00000217133	0.748	Tubulin beta-1 chain
18	9606.ENSP00000463393	0.724	Vesicle-trafficking protein SEC22b
19	9606.ENSP00000348206	0.710	PRELI domain containing protein 3B
20	9606.ENSP00000023939	0.699	Protein RTF2 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008234	1.000	cysteine-type peptidase activity
GO:0005515	0.999	protein binding
GO:0004175	0.888	endopeptidase activity
GO:0004197	0.878	cysteine-type endopeptidase activity
GO:0008238	0.867	exopeptidase activity
GO:0004180	0.854	carboxypeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050789	0.992	regulation of biological process
GO:0050794	0.956	regulation of cellular process
GO:0071704	0.895	organic substance metabolic process
GO:0006508	0.891	proteolysis
GO:0032501	0.856	multicellular organismal process
GO:0009987	0.854	cellular process
GO:0048519	0.820	negative regulation of biological process
GO:0010941	0.769	regulation of cell death
GO:0019222	0.734	regulation of metabolic process
GO:0060255	0.690	regulation of macromolecule metabolic process
GO:0080090	0.670	regulation of primary metabolic process
GO:0051171	0.670	regulation of nitrogen compound metabolic process
GO:0065008	0.580	regulation of biological quality
GO:0051246	0.580	regulation of protein metabolic process
GO:0009892	0.573	negative regulation of metabolic process
GO:0010468	0.556	regulation of gene expression
GO:0010605	0.546	negative regulation of macromolecule metabolic process
GO:0016485	0.545	protein processing
GO:1901214	0.464	regulation of neuron death
GO:0051248	0.459	negative regulation of protein metabolic process
GO:0003008	0.424	system process
GO:0048518	0.417	positive regulation of biological process
GO:0030162	0.402	regulation of proteolysis
GO:0050886	0.375	endocrine process
GO:1903317	0.368	regulation of protein maturation
GO:0003073	0.359	regulation of systemic arterial blood pressure
GO:0140448	0.350	signaling receptor ligand precursor processing
GO:0050896	0.331	response to stimulus
GO:0003044	0.330	regulation of systemic arterial blood pressure mediated by a chemical signal
GO:1903318	0.330	negative regulation of protein maturation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005576	0.996	extracellular region
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0016020	0.993	membrane
GO:0031982	0.992	vesicle
GO:0071944	0.988	cell periphery
GO:0005615	0.987	extracellular space
GO:0031410	0.984	cytoplasmic vesicle
GO:0005886	0.962	plasma membrane
GO:0031090	0.960	organelle membrane
GO:0098588	0.947	bounding membrane of organelle
GO:0070013	0.945	intracellular organelle lumen
GO:0099503	0.943	secretory vesicle
GO:0030135	0.897	coated vesicle
GO:0005773	0.886	vacuole
GO:0030141	0.871	secretory granule
GO:1903561	0.859	extracellular vesicle
GO:0000323	0.857	lytic vacuole
GO:0070062	0.844	extracellular exosome
GO:0005783	0.830	endoplasmic reticulum
GO:0005764	0.829	lysosome
GO:0031012	0.807	extracellular matrix
GO:0062023	0.775	collagen-containing extracellular matrix
GO:0030134	0.738	COPII-coated ER to Golgi transport vesicle
GO:0012506	0.735	vesicle membrane
GO:0030659	0.698	cytoplasmic vesicle membrane
GO:0060205	0.533	cytoplasmic vesicle lumen
GO:0034774	0.493	secretory granule lumen
GO:0005793	0.449	endoplasmic reticulum-Golgi intermediate compartment
GO:0101002	0.418	ficolin-1-rich granule
GO:0030133	0.409	transport vesicle
GO:0033116	0.345	endoplasmic reticulum-Golgi intermediate compartment membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.22.-	0.878	Cysteine endopeptidases.
RHEA:28783	0.854	H2O + L-cysteinylglycine = glycine + L-cysteine

[back to server]