StarFunc result for job id Q9UBR4

User Input

>input (397 residues)
MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSD
CHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVV
CKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKS
DKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGL
AGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRV
LAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBR4	1.000	1.000	5.301E-66	397	1.000	1.000	Q9UBR4.pdb.gz	LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens OX=9606 GN=LHX3 PE=1 SV=2
2	AFDB:A2ALD8	0.507	0.501	3.533E-55	402	0.877	0.866	A2ALD8.pdb.gz	A2ALD8_MOUSE LIM homeobox protein 3 OS=Mus musculus OX=10090 GN=Lhx3 PE=2 SV=1
3	AFDB:P36200	0.587	0.589	4.036E-52	395	0.763	0.767	P36200.pdb.gz	LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=8355 GN=lhx3 PE=1 SV=1
4	AFDB:Q90421	0.447	0.447	1.916E-51	398	0.748	0.746	Q90421.pdb.gz	LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio OX=7955 GN=lhx3 PE=2 SV=1
5	AFDB:B0S5S7	0.418	0.424	2.074E-45	391	0.655	0.665	B0S5S7.pdb.gz	B0S5S7_DANRE LIM homeobox 4 OS=Danio rerio OX=7955 GN=si:dkeyp-35f11.3 PE=4 SV=1
6	AFDB:P53776	0.543	0.552	9.846E-45	390	0.637	0.649	P53776.pdb.gz	LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus OX=10090 GN=Lhx4 PE=1 SV=4
7	AFDB:Q86P58	0.408	0.319	1.681E-31	523	0.481	0.365	Q86P58.pdb.gz	Q86P58_DROME RE70568p OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=2 SV=1
8	AFDB:P20271	0.342	0.385	8.001E-30	351	0.353	0.399	P20271.pdb.gz	HM14_CAEEL LIM/homeobox protein ceh-14 OS=Caenorhabditis elegans OX=6239 GN=ceh-14 PE=1 SV=3
9	AFDB:P61375	0.313	0.310	1.809E-27	402	0.360	0.356	P61375.pdb.gz	LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090 GN=Lhx5 PE=2 SV=1
10	AFDB:P37137	0.312	0.308	3.177E-26	402	0.365	0.361	P37137.pdb.gz	LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis OX=8355 GN=lhx5 PE=1 SV=2
11	PDB:4kfzB	0.167	0.410	7.613E-12	148	0.126	0.338	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.150	0.301	3.057E-4	192	0.063	0.130	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.144	0.643	1.364E-3	76	0.045	0.237	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4egcA	0.118	0.087	4.755E-2	539	0.040	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
15	PDB:2hi3A	0.133	0.617	1.211E-1	73	0.040	0.219	2hi3A.pdb.gz
16	PDB:6lss7	0.075	0.195	4.210E-1	135	0.048	0.141	6lss7.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:6ft6u	0.087	0.179	4.480E-1	150	0.048	0.127	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
18	PDB:7dcoL	0.101	0.093	4.768E-1	435	0.040	0.037	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:5ds9B	0.082	0.282	5.401E-1	98	0.015	0.061	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
20	PDB:7uhyA	0.054	0.032	6.930E-1	771	0.040	0.021	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ALD8	0.0	692	402	0.879	0.868	A2ALD8_MOUSE LIM homeobox protein 3 OS=Mus musculus OX=10090 GN=Lhx3 PE=2 SV=1
2	B0S5S7	0.0	517	391	0.640	0.650	B0S5S7_DANRE LIM homeobox 4 OS=Danio rerio OX=7955 GN=si:dkeyp-35f11.3 PE=4 SV=1
3	G3V8E3	0.0	729	400	0.919	0.912	G3V8E3_RAT LIM homeobox 3 OS=Rattus norvegicus OX=10116 GN=Lhx3 PE=4 SV=1
4	G3V9E7	0.0	711	402	0.884	0.873	G3V9E7_RAT LIM homeobox 3 OS=Rattus norvegicus OX=10116 GN=Lhx3 PE=4 SV=1
5	O97581	0.0	702	383	0.889	0.922	LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa OX=9823 GN=LHX3 PE=2 SV=1
6	P36200	0.0	628	395	0.776	0.780	LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=8355 GN=lhx3 PE=1 SV=1
7	P50481	0.0	709	400	0.914	0.907	LHX3_MOUSE LIM/homeobox protein Lhx3 OS=Mus musculus OX=10090 GN=Lhx3 PE=1 SV=1
8	Q90421	0.0	593	398	0.728	0.726	LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio OX=7955 GN=lhx3 PE=2 SV=1
9	Q9UBR4	0.0	816	397	1.000	1.000	LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens OX=9606 GN=LHX3 PE=1 SV=2
10	P53776	1.33e-175	496	390	0.637	0.649	LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus OX=10090 GN=Lhx4 PE=1 SV=4
11	Q969G2	9.44e-174	492	390	0.630	0.641	LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens OX=9606 GN=LHX4 PE=1 SV=2
12	M9NCY1	3.37e-113	338	405	0.474	0.464	M9NCY1_DROME Lim3, isoform E OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=4 SV=1
13	O96686	1.01e-112	338	440	0.474	0.427	O96686_DROME LIM homeodomain transcription factor OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=2 SV=1
14	Q9VJ02	1.01e-112	338	440	0.474	0.427	Q9VJ02_DROME Lim3, isoform A OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=4 SV=1
15	Q9VJ00	4.80e-112	339	520	0.474	0.362	Q9VJ00_DROME FI01025p OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=2 SV=2
16	M9PD53	5.99e-112	340	555	0.474	0.339	M9PD53_DROME Lim3, isoform G OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=4 SV=1
17	Q86P58	3.71e-110	335	523	0.474	0.359	Q86P58_DROME RE70568p OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=2 SV=1
18	P20271	2.10e-84	263	351	0.327	0.370	HM14_CAEEL LIM/homeobox protein ceh-14 OS=Caenorhabditis elegans OX=6239 GN=ceh-14 PE=1 SV=3
19	P37137	6.79e-76	243	402	0.307	0.303	LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis OX=8355 GN=lhx5 PE=1 SV=2
20	Q9H2C1	9.89e-76	242	402	0.300	0.296	LHX5_HUMAN LIM/homeobox protein Lhx5 OS=Homo sapiens OX=9606 GN=LHX5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11979 DUF3480	4e+02	11.3	Domain of unknown function (DUF3480)
2	PF15913 Furin-like_2	50	15.5	Furin-like repeat, cysteine-rich
3	PF05920 Homeobox_KN	1	20.6	Homeobox KN domain
4	PF00046 Homeodomain	2e-17	74.1	Homeodomain
5	PF00412 LIM	1e-27	107.4	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000015756

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000020906	0.932	LIM domain binding 1
2	9555.ENSPANP00000006425	0.878	ISL LIM homeobox 1
3	9555.ENSPANP00000018495	0.862	LIM domain binding 2
4	9555.ENSPANP00000009398	0.843	T-box 19
5	9555.ENSPANP00000014300	0.837	ISL LIM homeobox 2
6	9555.ENSPANP00000018297	0.809	Thyroid stimulating hormone beta
7	9555.ENSPANP00000003831	0.801	Glycoprotein hormones, alpha polypeptide
8	9555.ENSPANP00000010129	0.793	Diencephalon/mesencephalon homeobox 1
9	9555.ENSPANP00000002445	0.791	Follicle stimulating hormone, beta polypeptide
10	9555.ENSPANP00000002190	0.790	Neurogenic differentiation factor
11	9555.ENSPANP00000013755	0.786	Prolactin hormone
12	9555.ENSPANP00000018736	0.786	Belongs to the G-protein coupled receptor 2 family.
13	9555.ENSPANP00000008204	0.747	Proopiomelanocortin
14	9555.ENSPANP00000004713	0.743	ESX homeobox 1
15	9555.ENSPANP00000002122	0.734	Gonadotropin-releasing hormone receptor
16	9555.ENSPANP00000014799	0.710	annotation not available
17	9555.ENSPANP00000011691	0.709	Regulatory factor X, 6
18	9555.ENSPANP00000000449	0.704	Neurogenin 2
19	9555.ENSPANP00000010253	0.695	Uncharacterized protein
20	9555.ENSPANP00000011255	0.678	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0001228	0.986	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008134	0.985	transcription factor binding
GO:0003690	0.802	double-stranded DNA binding
GO:0140297	0.693	DNA-binding transcription factor binding
GO:0061629	0.615	RNA polymerase II-specific DNA-binding transcription factor binding
GO:1990837	0.612	sequence-specific double-stranded DNA binding
GO:0001067	0.415	transcription regulatory region nucleic acid binding
GO:0000976	0.414	transcription cis-regulatory region binding
GO:0001221	0.365	transcription coregulator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0048856	0.995	anatomical structure development
GO:0050794	0.992	regulation of cellular process
GO:0007275	0.990	multicellular organism development
GO:0048731	0.984	system development
GO:0048513	0.958	animal organ development
GO:0009987	0.924	cellular process
GO:0019222	0.886	regulation of metabolic process
GO:0060255	0.882	regulation of macromolecule metabolic process
GO:0080090	0.850	regulation of primary metabolic process
GO:0009889	0.849	regulation of biosynthetic process
GO:0051171	0.847	regulation of nitrogen compound metabolic process
GO:0031323	0.840	regulation of cellular metabolic process
GO:0010468	0.833	regulation of gene expression
GO:0048518	0.826	positive regulation of biological process
GO:0019219	0.823	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.797	regulation of cellular biosynthetic process
GO:0050896	0.796	response to stimulus
GO:2001141	0.791	regulation of RNA biosynthetic process
GO:0006355	0.759	regulation of DNA-templated transcription
GO:0048522	0.755	positive regulation of cellular process
GO:0009893	0.711	positive regulation of metabolic process
GO:0031325	0.704	positive regulation of cellular metabolic process
GO:0009891	0.703	positive regulation of biosynthetic process
GO:0051173	0.537	positive regulation of nitrogen compound metabolic process
GO:0006357	0.506	regulation of transcription by RNA polymerase II
GO:0010604	0.488	positive regulation of macromolecule metabolic process
GO:0045944	0.444	positive regulation of transcription by RNA polymerase II
GO:0051716	0.348	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005634	0.994	nucleus
GO:0032991	0.945	protein-containing complex
GO:0031974	0.309	membrane-enclosed lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]