StarFunc result for job id Q9UBS8

User Input

>input (474 residues)
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQN
SGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGS
VVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQE
EIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRH
VYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSL
DLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDL
RNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKM
TCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBS8	1.000	1.000	1.180E-95	474	1.000	1.000	Q9UBS8.pdb.gz	RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
2	AFDB:F1RB95	0.796	0.820	6.063E-65	459	0.563	0.582	F1RB95.pdb.gz	RNF14_DANRE E3 ubiquitin-protein ligase RNF14 OS=Danio rerio OX=7955 GN=rnf14 PE=2 SV=1
3	AFDB:Q9US46	0.509	0.549	8.273E-38	435	0.291	0.317	Q9US46.pdb.gz	ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=itt1 PE=3 SV=1
4	AFDB:Q20871	0.677	0.725	2.660E-37	437	0.295	0.320	Q20871.pdb.gz	Q20871_CAEEL RBR-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=CELE_F56D2.5 PE=1 SV=2
5	AFDB:Q04638	0.536	0.544	6.110E-26	464	0.200	0.205	Q04638.pdb.gz	ITT1_YEAST Translation termination inhibitor protein ITT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ITT1 PE=1 SV=1
6	AFDB:Q7Z419	0.264	0.401	1.075E-15	303	0.133	0.208	Q7Z419.pdb.gz	R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens OX=9606 GN=RNF144B PE=1 SV=1
7	AFDB:P50876	0.279	0.438	1.140E-15	292	0.131	0.212	P50876.pdb.gz	R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=2
8	AFDB:F4ITM1	0.237	0.276	8.577E-14	398	0.143	0.171	F4ITM1.pdb.gz	RGSL1_ARATH E3 ubiquitin-protein ligase RSL1 OS=Arabidopsis thaliana OX=3702 GN=RSL1 PE=1 SV=1
9	AFDB:Q6T486	0.259	0.238	1.729E-13	520	0.194	0.177	Q6T486.pdb.gz	RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum OX=44689 GN=rbrA PE=3 SV=1
10	AFDB:Q8W468	0.258	0.219	4.664E-13	567	0.160	0.134	Q8W468.pdb.gz	ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana OX=3702 GN=ARI8 PE=2 SV=1
11	PDB:7od1A	0.262	0.283	1.704E-11	430	0.124	0.137	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
12	PDB:5tteB	0.233	0.247	7.336E-11	442	0.133	0.143	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
13	PDB:7b5lH	0.262	0.291	1.567E-10	423	0.127	0.142	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
14	PDB:4kblA	0.216	0.252	4.124E-9	395	0.122	0.147	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
15	PDB:4zynB	0.174	0.204	1.675E-8	385	0.133	0.164	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
16	PDB:7oniH	0.256	0.311	3.488E-7	380	0.097	0.121	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:6raz2	0.077	0.067	4.512E-1	559	0.034	0.029	6raz2.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
18	PDB:8d0kF	0.076	0.048	4.783E-1	915	0.051	0.026	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
19	PDB:1tlbA	0.076	0.102	5.070E-1	326	0.044	0.064	1tlbA.pdb.gz
20	PDB:2mt6A	0.118	0.323	5.070E-1	151	0.036	0.113	2mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6RA38	0.0	570	278	0.586	1.000	D6RA38_HUMAN Ring finger protein 14 (Fragment) OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
2	F1RB95	0.0	552	459	0.555	0.573	RNF14_DANRE E3 ubiquitin-protein ligase RNF14 OS=Danio rerio OX=7955 GN=rnf14 PE=2 SV=1
3	Q9UBS8	0.0	978	474	1.000	1.000	RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
4	D6RBU3	9.80e-133	382	185	0.390	1.000	D6RBU3_HUMAN Ring finger protein 14 (Fragment) OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
5	Q9US46	3.14e-66	221	435	0.310	0.338	ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=itt1 PE=3 SV=1
6	Q20871	9.42e-66	219	437	0.310	0.336	Q20871_CAEEL RBR-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=CELE_F56D2.5 PE=1 SV=2
7	Q04638	6.23e-23	103	464	0.148	0.151	ITT1_YEAST Translation termination inhibitor protein ITT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ITT1 PE=1 SV=1
8	Q9P3U4	7.44e-22	100	504	0.137	0.129	HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbl4 PE=3 SV=1
9	Q6T486	1.58e-21	99.8	520	0.148	0.135	RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum OX=44689 GN=rbrA PE=3 SV=1
10	Q7Z419	5.41e-19	89.7	303	0.141	0.221	R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens OX=9606 GN=RNF144B PE=1 SV=1
11	O95376	2.54e-18	89.7	493	0.120	0.116	ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens OX=9606 GN=ARIH2 PE=1 SV=1
12	Q6IBL8	2.54e-18	89.7	493	0.120	0.116	Q6IBL8_HUMAN RBR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=ARIH2 PE=2 SV=1
13	Q8W468	1.42e-17	87.8	567	0.152	0.127	ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana OX=3702 GN=ARI8 PE=2 SV=1
14	Q9Z1K6	1.50e-17	87.4	492	0.116	0.112	ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus OX=10090 GN=Arih2 PE=1 SV=1
15	Q94981	1.74e-17	87.0	503	0.129	0.121	ARI1_DROME E3 ubiquitin-protein ligase ariadne-1 OS=Drosophila melanogaster OX=7227 GN=ari-1 PE=1 SV=2
16	Q9Z1K5	1.71e-16	84.3	555	0.133	0.114	ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus OX=10090 GN=Arih1 PE=1 SV=3
17	Q9Y4X5	1.93e-16	84.0	557	0.133	0.113	ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2
18	Q9P2G1	3.97e-16	84.0	1089	0.124	0.054	AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKIB1 PE=1 SV=3
19	H7C3G0	3.52e-15	77.8	264	0.133	0.239	H7C3G0_HUMAN RBR-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=1
20	P50876	7.78e-15	77.0	292	0.133	0.216	R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01485 IBR	3.2e-11	54.5	IBR domain, a half RING-finger domain
2	PF05773 RWD	1.6e-20	84.9	RWD domain
3	PF10544 T5orf172	35	16.3	T5orf172 domain
4	PF07106 TBPIP	4.1e+02	12.3	TBPIP/Hop2 winged helix domain
5	PF13639 zf-RING_2	5.9	18.6	Ring finger domain
6	PF14634 zf-RING_5	6.8	18.1	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378028

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363822	0.988	Androgen receptor
2	9606.ENSP00000400906	0.879	Ubiquitin-conjugating enzyme E2L 3
3	9606.ENSP00000485133	0.841	Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-live [...]
4	9606.ENSP00000432282	0.751	Transgelin
5	9606.ENSP00000253814	0.726	NEDD4 family-interacting protein 1
6	9606.ENSP00000463027	0.726	Nuclear receptor coactivator 4
7	9606.ENSP00000371000	0.683	E3 ubiquitin-protein ligase RNF6
8	9606.ENSP00000290299	0.679	ATP synthase subunit O, mitochondrial
9	9606.ENSP00000358777	0.679	V-type proton ATPase subunit S1
10	9606.ENSP00000394107	0.679	annotation not available
11	9606.ENSP00000379931	0.675	Ubiquitin-conjugating enzyme E2 E2
12	9606.ENSP00000418842	0.668	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
13	9606.ENSP00000378332	0.651	Transforming growth factor beta-1-induced transcript 1 protein
14	9606.ENSP00000359606	0.620	Box C/D snoRNA protein 1
15	9606.ENSP00000356814	0.612	DDB1- and CUL4-associated factor 6
16	9606.ENSP00000398131	0.591	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
17	9606.ENSP00000455229	0.583	tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
18	9606.ENSP00000341247	0.575	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
19	9606.ENSP00000357748	0.575	BRCA2 and CDKN1A-interacting protein
20	9606.ENSP00000374552	0.565	E3 ubiquitin-protein ligase RNF216

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	0.999	transcription coactivator activity
GO:0019787	0.999	ubiquitin-like protein transferase activity
GO:0050681	0.999	nuclear androgen receptor binding
GO:0004842	0.851	ubiquitin-protein transferase activity
GO:0061630	0.330	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0009987	0.982	cellular process
GO:0006807	0.961	nitrogen compound metabolic process
GO:0043170	0.938	macromolecule metabolic process
GO:0009966	0.900	regulation of signal transduction
GO:0019538	0.876	protein metabolic process
GO:0050896	0.796	response to stimulus
GO:0043412	0.737	macromolecule modification
GO:0010468	0.709	regulation of gene expression
GO:0051171	0.708	regulation of nitrogen compound metabolic process
GO:0048518	0.707	positive regulation of biological process
GO:0080090	0.705	regulation of primary metabolic process
GO:0031323	0.700	regulation of cellular metabolic process
GO:0048522	0.691	positive regulation of cellular process
GO:0036211	0.661	protein modification process
GO:0032446	0.649	protein modification by small protein conjugation
GO:0009893	0.579	positive regulation of metabolic process
GO:0051716	0.571	cellular response to stimulus
GO:0010556	0.564	regulation of macromolecule biosynthetic process
GO:0031326	0.556	regulation of cellular biosynthetic process
GO:0051173	0.547	positive regulation of nitrogen compound metabolic process
GO:0019219	0.546	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.544	positive regulation of macromolecule metabolic process
GO:0016567	0.489	protein ubiquitination
GO:0006355	0.484	regulation of DNA-templated transcription
GO:0031325	0.464	positive regulation of cellular metabolic process
GO:0006357	0.346	regulation of transcription by RNA polymerase II
GO:0010557	0.345	positive regulation of macromolecule biosynthetic process
GO:0045935	0.341	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.331	positive regulation of cellular biosynthetic process
GO:0045893	0.324	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]