StarFunc result for job id Q9UBS9

User Input

>input (1254 residues)
MKKHRRALALVSCLFLCSLVWLPSWRVCCKESSSASASSYYSQDDNCALENEDVQFQKKD
EREGPINAESLGKSGSNLPISPKEHKLKDDSIVDVQNTESKKLSPPVVETLPTVDLHEES
SNAVVDSETVENISSSSTSEITPISKLDEIEKSGTIPIAKPSETEQSETDCDVGEALDAS
APIEQPSFVSPPDSLVGQHIENVSSSHGKGKITKSEFESKVSASEQGGGDPKSALNASDN
LKNESSDYTKPGDIDPTSVASPKDPEDIPTFDEWKKKVMEVEKEKSQSMHASSNGGSHAT
KKVQKNRNNYASVECGAKILAANPEAKSTSAILIENMDLYMLNPCSTKIWFVIELCEPIQ
VKQLDIANYELFSSTPKDFLVSISDRYPTNKWIKLGTFHGRDERNVQSFPLDEQMYAKYV
KMFIKYIKVELLSHFGSEHFCPLSLIRVFGTSMVEEYEEIADSQYHSERQELFDEDYDYP
LDYNTGEDKSSKNLLGSATNAILNMVNIAANILGAKTEDLTEGNKSISENATATAAPKMP
ESTPVSTPVPSPEYVTTEVHTHDMEPSTPDTPKESPIVQLVQEEEEEASPSTVTLLGSGE
QEDESSPWFESETQIFCSELTTICCISSFSEYIYKWCSVRVALYRQRSRTALSKGKDYLV
LAQPPLLLPAESVDVSVLQPLSGELENTNIEREAETVVLGDLSSSMHQDDLVNHTVDAVE
LEPSHSQTLSQSLLLDITPEINPLPKIEVSESVEYEAGHIPSPVIPQESSVEIDNETEQK
SESFSSIEKPSITYETNKVNELMDNIIKEDVNSMQIFTKLSETIVPPINTATVPDNEDGE
AKMNIADTAKQTLISVVDSSSLPEVKEEEQSPEDALLRGLQRTATDFYAELQNSTDLGYA
NGNLVHGSNQKESVFMRLNNRIKALEVNMSLSGRYLEELSQRYRKQMEEMQKAFNKTIVK
LQNTSRIAEEQDQRQTEAIQLLQAQLTNMTQLVSNLSATVAELKREVSDRQSYLVISLVL
CVVLGLMLCMQRCRNTSQFDGDYISKLPKSNQYPSPKRCFSSYDDMNLKRRTSFPLMRSK
SLQLTGKEVDPNDLYIVEPLKFSPEKKKKRCKYKIEKIETIKPEEPLHPIANGDIKGRKP
FTNQRDFSNMGEVYHSSYKGPPSEGSSETSSQSEESYFCGISACTSLCNGQSQKTKTEKR
ALKRRRSKVQDQGKLIKTLIQTKSGSLPSLHDIIKGNKEITVGTFGVTAVSGHI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C341	0.370	0.371	0.000	1250	0.863	0.866	Q8C341.pdb.gz	SUCO_MOUSE SUN domain-containing ossification factor OS=Mus musculus OX=10090 GN=Suco PE=1 SV=3
2	PDB:1o59A	0.095	0.357	1.637E-7	318	0.018	0.069	1o59A.pdb.gz
3	PDB:7qe7L	0.091	0.535	1.739E-7	183	0.016	0.109	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
4	PDB:1xpwA	0.099	0.764	5.145E-7	143	0.015	0.133	1xpwA.pdb.gz
5	PDB:8a3tA	0.094	0.457	4.504E-6	219	0.012	0.068	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
6	AFDB:Q99NE5	0.044	0.040	6.867E-6	1463	0.098	0.084	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
7	PDB:1xoyA	0.093	0.568	8.230E-6	161	0.016	0.124	1xoyA.pdb.gz
8	PDB:7z8bC	0.092	0.094	8.230E-6	1224	0.014	0.015	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
9	AFDB:Q24432	0.054	0.065	1.255E-5	972	0.098	0.127	Q24432.pdb.gz	OMB_DROME Optomotor-blind protein OS=Drosophila melanogaster OX=7227 GN=bi PE=1 SV=3
10	AFDB:B0S8G4	0.073	0.059	2.032E-5	1645	0.124	0.095	B0S8G4.pdb.gz
11	PDB:1k12A	0.087	0.567	2.586E-5	158	0.014	0.108	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
12	PDB:6mdsA	0.096	0.150	2.747E-5	787	0.015	0.024	6mdsA.pdb.gz	Molecular Basis of Broad SpectrumN-Glycan Specificity and Processing of Therapeutic IgG Monoclonal Antibodies by Endoglycosidase S2.
13	PDB:4bxsV	0.076	0.076	4.449E-5	1262	0.016	0.016	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
14	AFDB:P39060	0.065	0.049	6.012E-5	1754	0.132	0.094	P39060.pdb.gz	COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1 PE=1 SV=5
15	PDB:7kveB	0.086	0.079	7.652E-5	1374	0.012	0.011	7kveB.pdb.gz
16	AFDB:Q9ET54	0.046	0.042	4.955E-4	1408	0.086	0.077	Q9ET54.pdb.gz	PALLD_MOUSE Palladin OS=Mus musculus OX=10090 GN=Palld PE=1 SV=2
17	AFDB:X2JE77	0.051	0.044	5.590E-4	1558	0.125	0.101	X2JE77.pdb.gz	X2JE77_DROME Chascon, isoform D OS=Drosophila melanogaster OX=7227 GN=chas PE=4 SV=1
18	AFDB:Q9HC77	0.063	0.060	6.698E-4	1338	0.124	0.116	Q9HC77.pdb.gz	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
19	AFDB:Q15424	0.037	0.048	2.105E-3	915	0.085	0.117	Q15424.pdb.gz	SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4
20	AFDB:O35569	0.038	0.048	2.845E-3	868	0.078	0.113	O35569.pdb.gz	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C341	0.0	2086	1250	0.862	0.865	SUCO_MOUSE SUN domain-containing ossification factor OS=Mus musculus OX=10090 GN=Suco PE=1 SV=3
2	Q12232	2.35e-38	154	587	0.061	0.131	SLP1_YEAST Uncharacterized protein SLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLP1 PE=1 SV=1
3	Q54MI3	2.40e-35	149	1278	0.055	0.054	SUN2_DICDI SUN domain-containing protein 2 OS=Dictyostelium discoideum OX=44689 GN=sun2 PE=3 SV=1
4	F4I8I0	4.23e-28	123	596	0.049	0.104	SUN4_ARATH SUN domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=SUN4 PE=1 SV=1
5	F4I316	2.25e-27	121	660	0.049	0.092	SUN3_ARATH SUN domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=SUN3 PE=1 SV=1
6	F4JPE9	3.10e-26	117	561	0.054	0.121	SUN5_ARATH SUN domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=SUN5 PE=1 SV=1
7	Q8TC36	0.62	36.6	379	0.018	0.061	SUN5_HUMAN SUN domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SUN5 PE=1 SV=1
8	Q582U6	3.3	34.3	618	0.023	0.047	Q582U6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.590 PE=4 SV=1
9	Q15149	4.5	34.3	4684	0.021	0.006	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
10	Q9QXS1	4.8	34.3	4691	0.020	0.005	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
11	O75112	7.4	33.1	727	0.018	0.032	LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens OX=9606 GN=LDB3 PE=1 SV=2
12	B0LK22	8.1	32.7	355	0.016	0.056	B0LK22_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt3 PE=2 SV=1
13	E9PW37	8.6	33.1	1286	0.021	0.020	E9PW37_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
14	Q0VAV5	8.7	33.1	1268	0.021	0.021	Q0VAV5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=2 SV=1
15	Q9VIF5	8.7	33.1	981	0.018	0.023	DEL_DROME Protein deadlock OS=Drosophila melanogaster OX=7227 GN=del PE=1 SV=2
16	D3YUS5	9.0	33.1	1261	0.021	0.021	D3YUS5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16492 Cadherin_C_2	0.24	23.4	Cadherin cytoplasmic C-terminal
2	PF04899 MbeD_MobD	1.4e+02	14.0	MbeD/MobD like
3	PF07738 Sad1_UNC	1e-35	134.0	Sad1 / UNC-like C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003824713.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008955226.1	0.726	Hypoxia-inducible factor 1-alpha isoform X1
2	9597.XP_008950394.1	0.693	Transmembrane anterior posterior transformation 1
3	9597.XP_003824229.1	0.691	Acylphosphatase-1 isoform X1
4	9597.XP_008965054.1	0.690	Retinal degeneration 3
5	9597.XP_008965629.1	0.659	E1A binding protein p300
6	9597.XP_003830881.2	0.639	Acylphosphatase-2
7	9597.XP_008951319.1	0.631	Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2
8	9597.XP_008961960.1	0.622	Cyclin G associated kinase
9	9597.XP_003822828.1	0.596	Myocyte enhancer factor 2C
10	9597.XP_003804251.1	0.592	Carboxypeptidase B2
11	9597.XP_008965260.1	0.568	Fc fragment of IgG receptor and transporter
12	9597.XP_003806140.1	0.561	Solute carrier family 33 member 1
13	9597.XP_003818495.1	0.539	Myosin light chain 3
14	9597.XP_008951468.1	0.537	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
15	9597.XP_008961369.1	0.527	Belongs to the NAD(P)-dependent epimerase/dehydratase family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.364	catalytic activity
GO:0042802	0.311	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0048522	0.983	positive regulation of cellular process
GO:0019222	0.978	regulation of metabolic process
GO:0009893	0.955	positive regulation of metabolic process
GO:0009889	0.944	regulation of biosynthetic process
GO:0051239	0.919	regulation of multicellular organismal process
GO:0045595	0.906	regulation of cell differentiation
GO:0034103	0.891	regulation of tissue remodeling
GO:0010712	0.891	regulation of collagen metabolic process
GO:0045667	0.891	regulation of osteoblast differentiation
GO:0045597	0.874	positive regulation of cell differentiation
GO:0045669	0.783	positive regulation of osteoblast differentiation
GO:0046850	0.722	regulation of bone remodeling
GO:0010714	0.721	positive regulation of collagen metabolic process
GO:0009987	0.682	cellular process
GO:0032965	0.590	regulation of collagen biosynthetic process
GO:0009891	0.539	positive regulation of biosynthetic process
GO:0032967	0.338	positive regulation of collagen biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005791	0.996	rough endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]