StarFunc result for job id Q9UBT2

User Input

>input (640 residues)
MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQ
FLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRA
ARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPS
EPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQ
NEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAAN
LRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGK
DVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNN
ADVSEEERSRKRKLDEKENLSAKRSRIEQKEELDDVIALD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBT2	1.000	1.000	0.000	640	1.000	1.000	Q9UBT2.pdb.gz	SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2
2	PDB:3kycB	0.850	0.992	1.110E-94	548	0.856	1.000	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.
3	PDB:6cwyD	0.508	0.659	6.823E-82	487	0.759	0.998	6cwyD.pdb.gz	Molecular mechanism of a covalent allosteric inhibitor of SUMO E1 activating enzyme.
4	AFDB:Q7KJV6	0.806	0.739	3.783E-75	700	0.481	0.440	Q7KJV6.pdb.gz	Q7KJV6_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=2 SV=1
5	PDB:6xoiB	0.622	0.986	3.875E-66	403	0.627	0.995	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
6	AFDB:Q9NAN1	0.772	0.847	5.979E-64	582	0.397	0.436	Q9NAN1.pdb.gz	SAE2_CAEEL SUMO-activating enzyme subunit uba-2 OS=Caenorhabditis elegans OX=6239 GN=uba-2 PE=3 SV=3
7	AFDB:Q5BAI0	0.622	0.651	4.505E-56	610	0.388	0.407	Q5BAI0.pdb.gz	Q5BAI0_EMENI Ubiquitin-like activating enzyme (UbaB), putative (AFU_orthologue AFUA_6G10510) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02450 PE=3 SV=1
8	AFDB:Q9SJT1	0.696	0.639	1.865E-55	700	0.356	0.326	Q9SJT1.pdb.gz	SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana OX=3702 GN=SAE2 PE=1 SV=1
9	AFDB:O42939	0.566	0.575	7.133E-52	628	0.347	0.354	O42939.pdb.gz	UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba2 PE=1 SV=1
10	AFDB:P52488	0.568	0.571	6.907E-48	636	0.309	0.311	P52488.pdb.gz	UBA2_YEAST Ubiquitin-activating enzyme E1-like OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA2 PE=1 SV=1
11	AFDB:Q8I553	0.575	0.538	2.427E-47	686	0.287	0.268	Q8I553.pdb.gz	Q8I553_PLAF7 SUMO-activating enzyme subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1237000 PE=3 SV=1
12	AFDB:Q57UC3	0.453	0.379	2.813E-45	796	0.316	0.254	Q57UC3.pdb.gz	Q57UC3_TRYB2 Ubiquitin-activating enzyme E1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.70 PE=4 SV=1
13	AFDB:Q09765	0.429	0.600	1.142E-28	444	0.181	0.261	Q09765.pdb.gz	UBA3_SCHPO NEDD8-activating enzyme E1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba3 PE=1 SV=1
14	PDB:4ii3A	0.470	0.314	8.058E-28	986	0.227	0.147	4ii3A.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
15	PDB:7pvnB	0.514	0.340	1.552E-27	990	0.217	0.140	7pvnB.pdb.gz	Structures of UBA6 explain its dual specificity for ubiquitin and FAT10.
16	PDB:2nvuB	0.436	0.359	2.831E-27	789	0.212	0.172	2nvuB.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.
17	PDB:7solA	0.482	0.314	3.720E-27	1011	0.219	0.138	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
18	PDB:5l6iA	0.455	0.298	5.164E-27	1007	0.216	0.137	5l6iA.pdb.gz	Dissecting the Specificity of Adenosyl Sulfamate Inhibitors Targeting the Ubiquitin-Activating Enzyme.
19	PDB:6dc6C	0.484	0.320	7.569E-27	996	0.234	0.151	6dc6C.pdb.gz	Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity.
20	PDB:7k5jI	0.458	0.313	1.901E-25	979	0.216	0.141	7k5jI.pdb.gz	Crystal structures of an E1-E2-ubiquitin thioester mimetic reveal molecular mechanisms of transthioesterification.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7KJV6	0.0	603	700	0.494	0.451	Q7KJV6_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=2 SV=1
2	Q7KUA4	0.0	603	700	0.494	0.451	Q7KUA4_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=1 SV=1
3	Q9UBT2	0.0	1324	640	1.000	1.000	SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2
4	Q9VSD9	0.0	598	700	0.492	0.450	Q9VSD9_DROME SUMO-activating enzyme subunit OS=Drosophila melanogaster OX=7227 GN=Uba2 PE=2 SV=3
5	Q9Z1F9	0.0	1241	638	0.941	0.944	SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus OX=10090 GN=Uba2 PE=1 SV=1
6	Q9NAN1	1.49e-165	488	582	0.398	0.438	SAE2_CAEEL SUMO-activating enzyme subunit uba-2 OS=Caenorhabditis elegans OX=6239 GN=uba-2 PE=3 SV=3
7	Q5BAI0	4.76e-136	413	610	0.364	0.382	Q5BAI0_EMENI Ubiquitin-like activating enzyme (UbaB), putative (AFU_orthologue AFUA_6G10510) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02450 PE=3 SV=1
8	Q9SJT1	2.62e-132	406	700	0.361	0.330	SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana OX=3702 GN=SAE2 PE=1 SV=1
9	O42939	8.95e-119	369	628	0.333	0.339	UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uba2 PE=1 SV=1
10	U3KQ93	6.28e-110	329	166	0.259	1.000	U3KQ93_HUMAN Ubiquitin like modifier activating enzyme 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=1
11	P52488	8.36e-99	317	636	0.341	0.343	UBA2_YEAST Ubiquitin-activating enzyme E1-like OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA2 PE=1 SV=1
12	Q57UC3	2.81e-81	275	796	0.302	0.242	Q57UC3_TRYB2 Ubiquitin-activating enzyme E1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.70 PE=4 SV=1
13	Q8I553	9.42e-59	211	686	0.230	0.214	Q8I553_PLAF7 SUMO-activating enzyme subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1237000 PE=3 SV=1
14	O94609	4.18e-46	178	1012	0.217	0.137	UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr3 PE=1 SV=1
15	Q8TBC4	3.70e-45	169	463	0.155	0.214	UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3 PE=1 SV=2
16	Q99MI7	5.57e-45	168	462	0.156	0.216	UBA3_RAT NEDD8-activating enzyme E1 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Uba3 PE=1 SV=1
17	Q57XC5	6.30e-45	174	1055	0.214	0.130	Q57XC5_TRYB2 Ubiquitin-activating enzyme E1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.680 PE=3 SV=1
18	Q8C878	6.47e-45	168	462	0.156	0.216	UBA3_MOUSE NEDD8-activating enzyme E1 catalytic subunit OS=Mus musculus OX=10090 GN=Uba3 PE=1 SV=2
19	P22515	3.13e-42	166	1024	0.219	0.137	UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA1 PE=1 SV=2
20	A0A024R1A3	6.04e-42	165	1058	0.233	0.141	A0A024R1A3_HUMAN E1 ubiquitin-activating enzyme OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13241 NAD_binding_7	7.4	18.4	Putative NAD(P)-binding
2	PF00899 ThiF	1.2e-64	229.1	ThiF family
3	PF14732 UAE_UbL	9.5e-19	79.1	Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
4	PF16195 UBA2_C	7.2e-23	92.3	SUMO-activating enzyme subunit 2 C-terminus
5	PF10585 UBA_E1_SCCH	0.0021	29.6	Ubiquitin-activating enzyme, SCCH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246548

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270225	0.999	SUMO-activating enzyme subunit 1
2	9606.ENSP00000348056	0.999	SUMO-conjugating enzyme UBC9
3	9606.ENSP00000376077	0.999	Small ubiquitin-related modifier 1
4	9606.ENSP00000405965	0.996	Small ubiquitin-related modifier 2
5	9606.ENSP00000409666	0.993	Small ubiquitin-like modifier 3
6	9606.ENSP00000318635	0.930	Small ubiquitin-related modifier 4
7	9606.ENSP00000359221	0.922	RWD domain-containing protein 3
8	9606.ENSP00000250495	0.898	NEDD8
9	9606.ENSP00000467024	0.885	UV excision repair protein RAD23 homolog A
10	9606.ENSP00000394791	0.875	Sentrin-specific protease 1
11	9606.ENSP00000283195	0.873	E3 SUMO-protein ligase RanBP2
12	9606.ENSP00000287437	0.870	E3 SUMO-protein ligase NSE2
13	9606.ENSP00000465676	0.847	E3 SUMO-protein ligase PIAS2
14	9606.ENSP00000401470	0.843	Ran GTPase-activating protein 1
15	9606.ENSP00000351990	0.835	NEDD8-activating enzyme E1 regulatory subunit
16	9606.ENSP00000402527	0.832	Sentrin-specific protease 6
17	9606.ENSP00000253023	0.824	NEDD8-conjugating enzyme Ubc12
18	9606.ENSP00000350708	0.817	UV excision repair protein RAD23 homolog B
19	9606.ENSP00000446271	0.808	Protein LSM14 homolog A
20	9606.ENSP00000342778	0.802	Protein phosphatase, Mg2+/Mn2+ dependent 1G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0008641	0.998	ubiquitin-like modifier activating enzyme activity
GO:0019948	0.979	SUMO activating enzyme activity
GO:0019899	0.962	enzyme binding
GO:1901363	0.958	heterocyclic compound binding
GO:0097159	0.958	organic cyclic compound binding
GO:0032182	0.738	ubiquitin-like protein binding
GO:0044390	0.726	ubiquitin-like protein conjugating enzyme binding
GO:0005524	0.721	ATP binding
GO:0000287	0.703	magnesium ion binding
GO:0032183	0.702	SUMO binding
GO:0046983	0.701	protein dimerization activity
GO:0046982	0.661	protein heterodimerization activity
GO:0044388	0.578	small protein activating enzyme binding
GO:0016740	0.505	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0050789	0.991	regulation of biological process
GO:0032446	0.987	protein modification by small protein conjugation
GO:0016925	0.963	protein sumoylation
GO:0019222	0.956	regulation of metabolic process
GO:0060255	0.943	regulation of macromolecule metabolic process
GO:0048518	0.940	positive regulation of biological process
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0080090	0.926	regulation of primary metabolic process
GO:0009893	0.854	positive regulation of metabolic process
GO:0010604	0.841	positive regulation of macromolecule metabolic process
GO:0050794	0.826	regulation of cellular process
GO:1903320	0.788	regulation of protein modification by small protein conjugation or removal
GO:0051173	0.750	positive regulation of nitrogen compound metabolic process
GO:0009987	0.699	cellular process
GO:0051247	0.689	positive regulation of protein metabolic process
GO:1903322	0.596	positive regulation of protein modification by small protein conjugation or removal
GO:0031323	0.394	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0140513	0.990	nuclear protein-containing complex
GO:1902494	0.987	catalytic complex
GO:0005737	0.961	cytoplasm
GO:0005829	0.910	cytosol
GO:0031510	0.443	SUMO activating enzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.-.-	0.998	Forming carbon-sulfur bonds.
EC:2.-.-.-	0.505	Transferases.

[back to server]