StarFunc result for job id Q9UBT3

User Input

>input (224 residues)
MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEK
PFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPV
QENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRG
HKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBT3	1.000	1.000	2.906E-44	224	1.000	1.000	Q9UBT3.pdb.gz	DKK4_HUMAN Dickkopf-related protein 4 OS=Homo sapiens OX=9606 GN=DKK4 PE=1 SV=1
2	AFDB:Q8VEJ3	0.683	0.691	4.527E-35	221	0.750	0.760	Q8VEJ3.pdb.gz	DKK4_MOUSE Dickkopf-related protein 4 OS=Mus musculus OX=10090 GN=Dkk4 PE=2 SV=1
3	AFDB:Q9QYZ8	0.360	0.314	5.073E-21	259	0.402	0.347	Q9QYZ8.pdb.gz	DKK2_MOUSE Dickkopf-related protein 2 OS=Mus musculus OX=10090 GN=Dkk2 PE=1 SV=2
4	AFDB:A8KB56	0.404	0.379	4.347E-20	243	0.362	0.333	A8KB56.pdb.gz	A8KB56_DANRE Dickkopf-related protein 2 precursor OS=Danio rerio OX=7955 GN=dkk2 PE=2 SV=1
5	AFDB:O54908	0.532	0.451	3.082E-19	272	0.388	0.320	O54908.pdb.gz	DKK1_MOUSE Dickkopf-related protein 1 OS=Mus musculus OX=10090 GN=Dkk1 PE=1 SV=2
6	AFDB:O94907	0.487	0.423	8.471E-19	266	0.344	0.289	O94907.pdb.gz	DKK1_HUMAN Dickkopf-related protein 1 OS=Homo sapiens OX=9606 GN=DKK1 PE=1 SV=1
7	AFDB:A8WGT5	0.442	0.399	1.404E-18	255	0.384	0.337	A8WGT5.pdb.gz	A8WGT5_DANRE LOC799377 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC799377 PE=2 SV=1
8	AFDB:A0A0B5JK99	0.448	0.420	2.328E-18	241	0.393	0.365	A0A0B5JK99.pdb.gz
9	PDB:1la4A	0.122	0.717	2.647E-1	34	0.045	0.294	1la4A.pdb.gz
10	PDB:5irxF	0.121	0.336	4.674E-1	75	0.085	0.253	5irxF.pdb.gz	TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action.
11	PDB:5epmC	0.115	0.711	8.253E-1	33	0.031	0.212	5epmC.pdb.gz
12	PDB:7wrqB	0.175	0.225	1.284	167	0.062	0.084	7wrqB.pdb.gz
13	PDB:1g9pA	0.117	0.455	1.999	45	0.036	0.178	1g9pA.pdb.gz
14	PDB:1ha9A	0.105	0.634	2.129	34	0.036	0.235	1ha9A.pdb.gz
15	PDB:2m9lA	0.131	0.692	2.416	35	0.031	0.200	2m9lA.pdb.gz
16	PDB:2k8pA	0.076	0.086	3.314	189	0.098	0.116	2k8pA.pdb.gz
17	PDB:2m36A	0.112	0.562	3.314	38	0.040	0.237	2m36A.pdb.gz
18	PDB:2kniA	0.132	0.634	3.530	41	0.040	0.220	2kniA.pdb.gz
19	AFDB:P47074	0.112	0.062	7.747	515	0.134	0.058	P47074.pdb.gz	MAD3_YEAST Spindle assembly checkpoint component MAD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBT3	4.61e-165	456	224	1.000	1.000	DKK4_HUMAN Dickkopf-related protein 4 OS=Homo sapiens OX=9606 GN=DKK4 PE=1 SV=1
2	Q8VEJ3	1.43e-115	330	221	0.750	0.760	DKK4_MOUSE Dickkopf-related protein 4 OS=Mus musculus OX=10090 GN=Dkk4 PE=2 SV=1
3	Q9UBU2	1.68e-40	140	259	0.375	0.324	DKK2_HUMAN Dickkopf-related protein 2 OS=Homo sapiens OX=9606 GN=DKK2 PE=1 SV=1
4	Q9QYZ8	7.10e-40	139	259	0.375	0.324	DKK2_MOUSE Dickkopf-related protein 2 OS=Mus musculus OX=10090 GN=Dkk2 PE=1 SV=2
5	Q9PWH3	1.38e-39	138	240	0.371	0.346	Q9PWH3_DANRE Dickkopf WNT-signaling pathway inhibitor 1b OS=Danio rerio OX=7955 GN=DKK1 PE=2 SV=1
6	Q9W6D9	2.42e-38	135	241	0.366	0.340	Q9W6D9_DANRE Dickkopf-1 OS=Danio rerio OX=7955 GN=dkk1 PE=2 SV=1
7	O57464	1.47e-33	123	259	0.353	0.305	O57464_XENLA Dickkopf WNT signaling pathway inhibitor 1 S homeolog precursor OS=Xenopus laevis OX=8355 GN=dkk1.S PE=2 SV=1
8	A8WGT5	4.50e-32	119	255	0.371	0.325	A8WGT5_DANRE LOC799377 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC799377 PE=2 SV=1
9	A8KB56	1.02e-31	117	243	0.330	0.305	A8KB56_DANRE Dickkopf-related protein 2 precursor OS=Danio rerio OX=7955 GN=dkk2 PE=2 SV=1
10	O54908	2.13e-31	117	272	0.344	0.283	DKK1_MOUSE Dickkopf-related protein 1 OS=Mus musculus OX=10090 GN=Dkk1 PE=1 SV=2
11	O94907	9.34e-31	115	266	0.344	0.289	DKK1_HUMAN Dickkopf-related protein 1 OS=Homo sapiens OX=9606 GN=DKK1 PE=1 SV=1
12	Q9UBP4	1.35e-09	59.3	350	0.250	0.160	DKK3_HUMAN Dickkopf-related protein 3 OS=Homo sapiens OX=9606 GN=DKK3 PE=1 SV=2
13	Q9QUN9	2.42e-08	55.5	349	0.259	0.166	DKK3_MOUSE Dickkopf-related protein 3 OS=Mus musculus OX=10090 GN=Dkk3 PE=2 SV=1
14	Q14A28	0.004	38.1	105	0.098	0.210	PROK1_MOUSE Prokineticin-1 OS=Mus musculus OX=10090 GN=Prok1 PE=1 SV=1
15	Q8R414	0.005	37.7	105	0.098	0.210	PROK1_RAT Prokineticin-1 OS=Rattus norvegicus OX=10116 GN=Prok1 PE=3 SV=1
16	C1K6H6	0.006	39.3	293	0.116	0.089	C1K6H6_DANRE Dickkopf long isoform OS=Danio rerio OX=7955 GN=dkk3 PE=2 SV=1
17	D3GDN2	0.011	37.0	107	0.098	0.206	D3GDN2_DANRE Prokineticin OS=Danio rerio OX=7955 GN=prok2 PE=2 SV=1
18	P58294	0.012	36.6	105	0.098	0.210	PROK1_HUMAN Prokineticin-1 OS=Homo sapiens OX=9606 GN=PROK1 PE=1 SV=1
19	Q8R413	0.13	33.9	107	0.094	0.196	PROK2_RAT Prokineticin-2 OS=Rattus norvegicus OX=10116 GN=Prok2 PE=2 SV=1
20	A2Q862	2.0	32.0	1507	0.080	0.012	A2Q862_ASPNC Contig An01c0080, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g03190 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04706 Dickkopf_N	2.4e-15	67.9	Dickkopf N-terminal cysteine-rich region
2	PF06607 Prokineticin	0.32	22.7	Prokineticin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294304	0.993	Low-density lipoprotein receptor-related protein 5
2	9606.ENSP00000284523	0.944	Protein Wnt-3a
3	9606.ENSP00000293549	0.937	Proto-oncogene Wnt-1
4	9606.ENSP00000287934	0.931	Frizzled-1
5	9606.ENSP00000323901	0.929	Frizzled-2
6	9606.ENSP00000426653	0.924	Protein Wnt-8a
7	9606.ENSP00000340677	0.919	Protein Wnt-8b
8	9606.ENSP00000261349	0.915	Low-density lipoprotein receptor-related protein 6
9	9606.ENSP00000285311	0.910	Dickkopf-related protein 2
10	9606.ENSP00000363081	0.910	Dickkopf-related protein 1
11	9606.ENSP00000331242	0.857	Kremen protein 1
12	9606.ENSP00000233948	0.853	Protein Wnt-6
13	9606.ENSP00000358698	0.853	Protein Wnt-2b
14	9606.ENSP00000304422	0.839	Kremen protein 2
15	9606.ENSP00000301061	0.830	Protein Wnt-10b
16	9606.ENSP00000258411	0.790	Protein Wnt-10a
17	9606.ENSP00000265441	0.782	Protein Wnt-2
18	9606.ENSP00000325526	0.754	Protein Wnt-11
19	9606.ENSP00000264634	0.750	Protein Wnt-5a
20	9606.ENSP00000341032	0.744	Protein Wnt-7b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048519	0.982	negative regulation of biological process
GO:0050896	0.973	response to stimulus
GO:0007154	0.948	cell communication
GO:0023052	0.946	signaling
GO:0032502	0.934	developmental process
GO:0051716	0.892	cellular response to stimulus
GO:0048523	0.874	negative regulation of cellular process
GO:0048856	0.866	anatomical structure development
GO:0007165	0.828	signal transduction
GO:0009966	0.787	regulation of signal transduction
GO:0048518	0.766	positive regulation of biological process
GO:0030111	0.763	regulation of Wnt signaling pathway
GO:0009968	0.698	negative regulation of signal transduction
GO:0032501	0.681	multicellular organismal process
GO:0007267	0.681	cell-cell signaling
GO:0007275	0.654	multicellular organism development
GO:0007166	0.632	cell surface receptor signaling pathway
GO:1905114	0.616	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0050793	0.615	regulation of developmental process
GO:0016055	0.596	Wnt signaling pathway
GO:0030178	0.564	negative regulation of Wnt signaling pathway
GO:0051239	0.535	regulation of multicellular organismal process
GO:0048522	0.501	positive regulation of cellular process
GO:0048731	0.439	system development
GO:0051093	0.423	negative regulation of developmental process
GO:0048513	0.383	animal organ development
GO:0060828	0.376	regulation of canonical Wnt signaling pathway
GO:0019222	0.356	regulation of metabolic process
GO:0080090	0.343	regulation of primary metabolic process
GO:0060255	0.337	regulation of macromolecule metabolic process
GO:0051171	0.336	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005622	0.988	intracellular anatomical structure
GO:0005737	0.982	cytoplasm
GO:0005615	0.897	extracellular space
GO:0043231	0.690	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]