StarFunc result for job id Q9UBU2

User Input

>input (259 residues)
MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQG
LAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPST
RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEG
DPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK
VWKDATYSSKARLHVCQKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QYZ8	0.805	0.805	1.345E-47	259	0.954	0.954	Q9QYZ8.pdb.gz	DKK2_MOUSE Dickkopf-related protein 2 OS=Mus musculus OX=10090 GN=Dkk2 PE=1 SV=2
2	AFDB:A8KB56	0.463	0.487	1.820E-31	243	0.541	0.576	A8KB56.pdb.gz	A8KB56_DANRE Dickkopf-related protein 2 precursor OS=Danio rerio OX=7955 GN=dkk2 PE=2 SV=1
3	AFDB:O94907	0.410	0.402	1.499E-25	266	0.386	0.376	O94907.pdb.gz	DKK1_HUMAN Dickkopf-related protein 1 OS=Homo sapiens OX=9606 GN=DKK1 PE=1 SV=1
4	AFDB:A8WGT5	0.341	0.346	7.727E-25	255	0.359	0.365	A8WGT5.pdb.gz	A8WGT5_DANRE LOC799377 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC799377 PE=2 SV=1
5	AFDB:O57464	0.473	0.473	1.868E-24	259	0.371	0.371	O57464.pdb.gz	O57464_XENLA Dickkopf WNT signaling pathway inhibitor 1 S homeolog precursor OS=Xenopus laevis OX=8355 GN=dkk1.S PE=2 SV=1
6	AFDB:A0A0B5JK99	0.433	0.460	1.595E-23	241	0.355	0.382	A0A0B5JK99.pdb.gz
7	AFDB:Q8VEJ3	0.318	0.370	2.557E-22	221	0.344	0.403	Q8VEJ3.pdb.gz	DKK4_MOUSE Dickkopf-related protein 4 OS=Mus musculus OX=10090 GN=Dkk4 PE=2 SV=1
8	AFDB:Q9UBT3	0.325	0.374	4.804E-22	224	0.347	0.402	Q9UBT3.pdb.gz	DKK4_HUMAN Dickkopf-related protein 4 OS=Homo sapiens OX=9606 GN=DKK4 PE=1 SV=1
9	AFDB:B6ZI38	0.170	0.134	4.883E-3	349	0.139	0.103	B6ZI38.pdb.gz	DRAXI_CHICK Draxin OS=Gallus gallus OX=9031 GN=DRAXIN PE=1 SV=1
10	PDB:7wrqB	0.157	0.225	4.446E-1	167	0.058	0.090	7wrqB.pdb.gz
11	AFDB:Q9H3R2	0.101	0.064	5.531E-1	512	0.124	0.062	Q9H3R2.pdb.gz	MUC13_HUMAN Mucin-13 OS=Homo sapiens OX=9606 GN=MUC13 PE=1 SV=3
12	PDB:1la4A	0.106	0.720	7.842E-1	34	0.027	0.206	1la4A.pdb.gz
13	PDB:2kniA	0.115	0.626	1.009	41	0.042	0.268	2kniA.pdb.gz
14	PDB:2m9lA	0.101	0.655	1.075	35	0.031	0.229	2m9lA.pdb.gz
15	PDB:7q3nU	0.105	0.097	1.299	292	0.104	0.092	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
16	PDB:1ha9A	0.091	0.623	2.019	34	0.042	0.324	1ha9A.pdb.gz
17	PDB:4qi7A	0.121	0.042	2.768	805	0.015	0.005	4qi7A.pdb.gz	Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.
18	PDB:2ljsA	0.090	0.640	2.948	30	0.042	0.367	2ljsA.pdb.gz
19	PDB:3t5oA	0.099	0.050	3.140	871	0.073	0.022	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
20	PDB:1v90A	0.094	0.452	3.562	38	0.039	0.263	1v90A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBU2	0.0	532	259	1.000	1.000	DKK2_HUMAN Dickkopf-related protein 2 OS=Homo sapiens OX=9606 GN=DKK2 PE=1 SV=1
2	Q9QYZ8	2.35e-176	487	259	0.954	0.954	DKK2_MOUSE Dickkopf-related protein 2 OS=Mus musculus OX=10090 GN=Dkk2 PE=1 SV=2
3	A8KB56	7.42e-87	260	243	0.583	0.621	A8KB56_DANRE Dickkopf-related protein 2 precursor OS=Danio rerio OX=7955 GN=dkk2 PE=2 SV=1
4	O54908	5.21e-52	172	272	0.425	0.404	DKK1_MOUSE Dickkopf-related protein 1 OS=Mus musculus OX=10090 GN=Dkk1 PE=1 SV=2
5	Q9PWH3	5.38e-51	168	240	0.363	0.392	Q9PWH3_DANRE Dickkopf WNT-signaling pathway inhibitor 1b OS=Danio rerio OX=7955 GN=DKK1 PE=2 SV=1
6	O94907	2.40e-50	167	266	0.452	0.440	DKK1_HUMAN Dickkopf-related protein 1 OS=Homo sapiens OX=9606 GN=DKK1 PE=1 SV=1
7	Q9W6D9	1.85e-49	164	241	0.363	0.390	Q9W6D9_DANRE Dickkopf-1 OS=Danio rerio OX=7955 GN=dkk1 PE=2 SV=1
8	O57464	3.56e-46	157	259	0.344	0.344	O57464_XENLA Dickkopf WNT signaling pathway inhibitor 1 S homeolog precursor OS=Xenopus laevis OX=8355 GN=dkk1.S PE=2 SV=1
9	Q9UBT3	4.19e-41	142	224	0.371	0.429	DKK4_HUMAN Dickkopf-related protein 4 OS=Homo sapiens OX=9606 GN=DKK4 PE=1 SV=1
10	A8WGT5	3.14e-40	141	255	0.317	0.322	A8WGT5_DANRE LOC799377 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC799377 PE=2 SV=1
11	Q8VEJ3	3.52e-38	135	221	0.332	0.389	DKK4_MOUSE Dickkopf-related protein 4 OS=Mus musculus OX=10090 GN=Dkk4 PE=2 SV=1
12	C1K6H6	0.004	40.0	293	0.154	0.137	C1K6H6_DANRE Dickkopf long isoform OS=Danio rerio OX=7955 GN=dkk3 PE=2 SV=1
13	Q9QUN9	0.010	39.3	349	0.185	0.138	DKK3_MOUSE Dickkopf-related protein 3 OS=Mus musculus OX=10090 GN=Dkk3 PE=2 SV=1
14	Q8R414	0.036	35.4	105	0.089	0.219	PROK1_RAT Prokineticin-1 OS=Rattus norvegicus OX=10116 GN=Prok1 PE=3 SV=1
15	Q9UBP4	0.036	37.4	350	0.174	0.129	DKK3_HUMAN Dickkopf-related protein 3 OS=Homo sapiens OX=9606 GN=DKK3 PE=1 SV=2
16	P58294	0.071	34.7	105	0.089	0.219	PROK1_HUMAN Prokineticin-1 OS=Homo sapiens OX=9606 GN=PROK1 PE=1 SV=1
17	Q8R413	0.18	33.5	107	0.085	0.206	PROK2_RAT Prokineticin-2 OS=Rattus norvegicus OX=10116 GN=Prok2 PE=2 SV=1
18	Q14A28	0.28	33.1	105	0.085	0.210	PROK1_MOUSE Prokineticin-1 OS=Mus musculus OX=10090 GN=Prok1 PE=1 SV=1
19	O22842	0.57	33.5	281	0.069	0.064	CHI61_ARATH Endochitinase At2g43610 OS=Arabidopsis thaliana OX=3702 GN=At2g43610 PE=1 SV=1
20	P58467	0.79	33.5	439	0.058	0.034	SETD4_MOUSE SET domain-containing protein 4 OS=Mus musculus OX=10090 GN=Setd4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04706 Dickkopf_N	1.1e-11	56.1	Dickkopf N-terminal cysteine-rich region
2	PF14946 DUF4501	1e+02	14.2	Domain of unknown function (DUF4501)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285311

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261349	0.998	Low-density lipoprotein receptor-related protein 6
2	9606.ENSP00000294304	0.994	Low-density lipoprotein receptor-related protein 5
3	9606.ENSP00000304422	0.970	Kremen protein 2
4	9606.ENSP00000284523	0.958	Protein Wnt-3a
5	9606.ENSP00000331242	0.949	Kremen protein 1
6	9606.ENSP00000287934	0.947	Frizzled-1
7	9606.ENSP00000293549	0.944	Proto-oncogene Wnt-1
8	9606.ENSP00000323901	0.942	Frizzled-2
9	9606.ENSP00000340677	0.941	Protein Wnt-8b
10	9606.ENSP00000426653	0.932	Protein Wnt-8a
11	9606.ENSP00000220812	0.910	Dickkopf-related protein 4
12	9606.ENSP00000363081	0.909	Dickkopf-related protein 1
13	9606.ENSP00000358698	0.859	Protein Wnt-2b
14	9606.ENSP00000233948	0.856	Protein Wnt-6
15	9606.ENSP00000379762	0.856	Dickkopf-related protein 3
16	9606.ENSP00000265441	0.836	Protein Wnt-2
17	9606.ENSP00000264634	0.827	Protein Wnt-5a
18	9606.ENSP00000341032	0.798	Protein Wnt-7b
19	9606.ENSP00000301061	0.796	Protein Wnt-10b
20	9606.ENSP00000325526	0.794	Protein Wnt-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0039706	0.698	co-receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048523	0.988	negative regulation of cellular process
GO:0009966	0.988	regulation of signal transduction
GO:0030111	0.983	regulation of Wnt signaling pathway
GO:0030178	0.963	negative regulation of Wnt signaling pathway
GO:0048518	0.874	positive regulation of biological process
GO:0048522	0.781	positive regulation of cellular process
GO:0032502	0.751	developmental process
GO:0048856	0.665	anatomical structure development
GO:0032501	0.658	multicellular organismal process
GO:0009987	0.654	cellular process
GO:0060828	0.634	regulation of canonical Wnt signaling pathway
GO:0007275	0.584	multicellular organism development
GO:0090090	0.508	negative regulation of canonical Wnt signaling pathway
GO:0048731	0.376	system development
GO:0048513	0.352	animal organ development
GO:0060255	0.310	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.986	extracellular space
GO:0005622	0.948	intracellular anatomical structure
GO:0005737	0.917	cytoplasm
GO:0043231	0.693	intracellular membrane-bounded organelle
GO:0016020	0.529	membrane
GO:0071944	0.348	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]