StarFunc result for job id Q9UBU3

User Input

>input (117 residues)
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBU3	1.000	1.000	1.481E-18	117	1.000	1.000	Q9UBU3.pdb.gz	GHRL_HUMAN Appetite-regulating hormone OS=Homo sapiens OX=9606 GN=GHRL PE=1 SV=1
2	AFDB:Q9EQX0	0.571	0.571	9.545E-15	117	0.838	0.838	Q9EQX0.pdb.gz	GHRL_MOUSE Appetite-regulating hormone OS=Mus musculus OX=10090 GN=Ghrl PE=1 SV=1
3	AFDB:Q30DT1	0.422	0.453	2.034E-10	107	0.650	0.710	Q30DT1.pdb.gz	Q30DT1_SHEEP Appetite-regulating hormone (Fragment) OS=Ovis aries OX=9940 GN=GHRL PE=2 SV=1
4	AFDB:Q9GKY5	0.232	0.230	3.314E-9	118	0.786	0.780	Q9GKY5.pdb.gz	GHRL_PIG Appetite-regulating hormone OS=Sus scrofa OX=9823 GN=GHRL PE=3 SV=1
5	AFDB:Q7T1B9	0.306	0.308	4.235E-7	116	0.368	0.371	Q7T1B9.pdb.gz	Q7T1B9_MELGA Appetite-regulating hormone OS=Meleagris gallopavo OX=9103 GN=GHRL PE=2 SV=1
6	AFDB:Q8JFY4	0.228	0.235	3.479E-4	111	0.291	0.306	Q8JFY4.pdb.gz	GHRL_ANGJA Ghrelin OS=Anguilla japonica OX=7937 GN=ghrl PE=1 SV=1
7	AFDB:Q4LET8	0.225	0.233	1.404E-3	108	0.274	0.296	Q4LET8.pdb.gz	Q4LET8_ICTPU Preproghrelin-2 OS=Ictalurus punctatus OX=7998 PE=2 SV=1
8	AFDB:F1QR43	0.182	0.061	3.054E-1	586	0.137	0.027	F1QR43.pdb.gz	GLCEB_DANRE D-glucuronyl C5-epimerase B OS=Danio rerio OX=7955 GN=glceb PE=1 SV=1
9	AFDB:Q29RD8	0.200	0.051	3.488E-1	585	0.103	0.021	Q29RD8.pdb.gz	Q29RD8_DANRE heparosan-N-sulfate-glucuronate 5-epimerase OS=Danio rerio OX=7955 GN=glcel PE=2 SV=1
10	AFDB:Q93ZM9	0.290	0.198	6.778E-1	197	0.120	0.071	Q93ZM9.pdb.gz	TIF9_ARATH Protein TIFY 9 OS=Arabidopsis thaliana OX=3702 GN=TIFY9 PE=1 SV=1
11	PDB:4yduC	0.155	0.098	2.415	230	0.077	0.039	4yduC.pdb.gz	The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
12	PDB:4wx8E	0.181	0.309	3.150	61	0.085	0.164	4wx8E.pdb.gz
13	PDB:4wxaE	0.175	0.290	3.150	69	0.060	0.101	4wxaE.pdb.gz
14	PDB:5fpnA	0.191	0.071	3.150	379	0.017	0.005	5fpnA.pdb.gz	Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
15	PDB:2qxlB	0.197	0.046	3.366	625	0.051	0.010	2qxlB.pdb.gz	Insights into hsp70 chaperone activity from a crystal structure of the yeast hsp110 Sse1.
16	PDB:7kw7C	0.194	0.056	3.366	511	0.017	0.004	7kw7C.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
17	PDB:7pmkX	0.126	0.037	3.366	665	0.051	0.009	7pmkX.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:4v96Bd	0.123	0.095	3.845	165	0.085	0.061	4v96Bd.pdb.gz
19	PDB:6asyA	0.193	0.048	3.845	606	0.026	0.005	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
20	PDB:7abzX	0.194	0.279	3.845	77	0.043	0.065	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBU3	1.04e-81	236	117	1.000	1.000	GHRL_HUMAN Appetite-regulating hormone OS=Homo sapiens OX=9606 GN=GHRL PE=1 SV=1
2	Q9EQX0	5.38e-56	171	117	0.838	0.838	GHRL_MOUSE Appetite-regulating hormone OS=Mus musculus OX=10090 GN=Ghrl PE=1 SV=1
3	Q9GKY5	5.93e-56	171	118	0.786	0.780	GHRL_PIG Appetite-regulating hormone OS=Sus scrofa OX=9823 GN=GHRL PE=3 SV=1
4	Q9QYH7	2.88e-54	167	117	0.829	0.829	GHRL_RAT Appetite-regulating hormone OS=Rattus norvegicus OX=10116 GN=Ghrl PE=1 SV=1
5	Q30DT1	1.54e-44	142	107	0.598	0.654	Q30DT1_SHEEP Appetite-regulating hormone (Fragment) OS=Ovis aries OX=9940 GN=GHRL PE=2 SV=1
6	Q7T1B9	1.74e-23	89.4	116	0.359	0.362	Q7T1B9_MELGA Appetite-regulating hormone OS=Meleagris gallopavo OX=9103 GN=GHRL PE=2 SV=1
7	Q7T2V1	3.20e-23	88.6	116	0.350	0.353	Q7T2V1_CHICK Appetite-regulating hormone OS=Gallus gallus OX=9031 GN=ghr PE=2 SV=1
8	Q8AV73	3.53e-23	88.6	116	0.350	0.353	Q8AV73_CHICK Appetite-regulating hormone OS=Gallus gallus OX=9031 GN=ghr PE=2 SV=1
9	Q2V0H4	4.38e-12	58.5	65	0.222	0.400	Q2V0H4_COTJA Appetite-regulating hormone (Fragment) OS=Coturnix japonica OX=93934 GN=GHR PE=2 SV=1
10	Q8JFY4	4.25e-10	54.7	111	0.350	0.369	GHRL_ANGJA Ghrelin OS=Anguilla japonica OX=7937 GN=ghrl PE=1 SV=1
11	A8R5N8	4.41e-07	47.0	111	0.308	0.324	A8R5N8_ONCKE Preproghrelin-1 (Fragment) OS=Oncorhynchus keta OX=8018 PE=2 SV=2
12	Q76IQ4	4.41e-07	47.0	111	0.308	0.324	GHRL_ONCMY Ghrelin OS=Oncorhynchus mykiss OX=8022 GN=ghrl PE=1 SV=1
13	G3LXI2	1.50e-06	43.9	36	0.162	0.528	G3LXI2_CHICK Ghrelin (Fragment) OS=Gallus gallus OX=9031 PE=3 SV=1
14	B3IYK1	1.86e-06	45.4	111	0.299	0.315	B3IYK1_SALSA Appetite-regulating hormone isoform X1 OS=Salmo salar OX=8030 GN=GHRL-1 PE=2 SV=1
15	Q4LET9	1.43e-05	43.1	108	0.274	0.296	Q4LET9_ICTPU Ghrelin/obestatin prepropeptide precursor OS=Ictalurus punctatus OX=7998 GN=ghrl PE=2 SV=1
16	Q4LET8	1.53e-05	42.7	108	0.274	0.296	Q4LET8_ICTPU Preproghrelin-2 OS=Ictalurus punctatus OX=7998 PE=2 SV=1
17	B3IYK2	1.63e-05	42.7	108	0.274	0.296	B3IYK2_SALSA Appetite-regulating hormone precursor OS=Salmo salar OX=8030 GN=GHRL-2 PE=2 SV=1
18	E9QFU1	0.011	35.0	104	0.274	0.308	E9QFU1_DANRE Motilin-like OS=Danio rerio OX=7955 GN=mlnl PE=4 SV=1
19	P12872	0.24	31.6	115	0.188	0.191	MOTI_HUMAN Promotilin OS=Homo sapiens OX=9606 GN=MLN PE=1 SV=1
20	Q3UZZ4	0.99	30.8	505	0.188	0.044	OLFM4_MOUSE Olfactomedin-4 OS=Mus musculus OX=10090 GN=Olfm4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04643 Motilin_assoc	3e-30	115.2	Motilin/ghrelin-associated peptide
2	PF04644 Motilin_ghrelin	8.7e-11	52.9	Motilin/ghrelin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335074

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241256	0.998	Growth hormone secretagogue receptor type 1
2	9606.ENSP00000314196	0.995	Ghrelin O-acyltransferase
3	9606.ENSP00000312652	0.994	Leptin
4	9606.ENSP00000327417	0.989	G-protein coupled receptor 39
5	9606.ENSP00000380432	0.988	Insulin
6	9606.ENSP00000362716	0.982	Somatoliberin
7	9606.ENSP00000302665	0.975	Insulin-like growth factor I
8	9606.ENSP00000312673	0.970	Somatotropin
9	9606.ENSP00000379472	0.961	Cholecystokinin
10	9606.ENSP00000296099	0.956	Urocortin
11	9606.ENSP00000264381	0.955	Cholinesterase
12	9606.ENSP00000384364	0.955	Pro-neuropeptide Y
13	9606.ENSP00000340943	0.951	Corticotropin-releasing factor receptor 2
14	9606.ENSP00000293330	0.949	Orexin
15	9606.ENSP00000290953	0.948	Agouti-related protein
16	9606.ENSP00000308024	0.943	Neuroendocrine convertase 1
17	9606.ENSP00000353198	0.940	Peptide YY
18	9606.ENSP00000387662	0.938	Glucagon
19	9606.ENSP00000303211	0.923	Acetylcholinesterase
20	9606.ENSP00000388825	0.921	Promotilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001664	1.000	G protein-coupled receptor binding
GO:0005179	1.000	hormone activity
GO:0031768	0.972	ghrelin receptor binding
GO:0016608	0.863	growth hormone-releasing hormone activity
GO:0019207	0.856	kinase regulator activity
GO:0030295	0.852	protein kinase activator activity
GO:0030296	0.809	protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0009987	0.985	cellular process
GO:0032501	0.978	multicellular organismal process
GO:0065008	0.972	regulation of biological quality
GO:0023052	0.967	signaling
GO:0007154	0.967	cell communication
GO:0051716	0.954	cellular response to stimulus
GO:0046887	0.935	positive regulation of hormone secretion
GO:0007165	0.931	signal transduction
GO:0090276	0.927	regulation of peptide hormone secretion
GO:0003008	0.920	system process
GO:0051240	0.918	positive regulation of multicellular organismal process
GO:0048519	0.917	negative regulation of biological process
GO:0032101	0.916	regulation of response to external stimulus
GO:1903555	0.916	regulation of tumor necrosis factor superfamily cytokine production
GO:0051241	0.912	negative regulation of multicellular organismal process
GO:0044057	0.909	regulation of system process
GO:0090277	0.904	positive regulation of peptide hormone secretion
GO:0001818	0.903	negative regulation of cytokine production
GO:0007267	0.886	cell-cell signaling
GO:0032502	0.878	developmental process
GO:0032680	0.876	regulation of tumor necrosis factor production
GO:1903556	0.875	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0048856	0.874	anatomical structure development
GO:0032720	0.867	negative regulation of tumor necrosis factor production
GO:0048523	0.849	negative regulation of cellular process
GO:0009605	0.847	response to external stimulus
GO:0050708	0.828	regulation of protein secretion
GO:0050795	0.823	regulation of behavior
GO:0051179	0.797	localization
GO:0051094	0.795	positive regulation of developmental process
GO:0007275	0.773	multicellular organism development
GO:0009893	0.768	positive regulation of metabolic process
GO:0006810	0.767	transport
GO:0032104	0.767	regulation of response to extracellular stimulus
GO:0051224	0.765	negative regulation of protein transport
GO:0044087	0.762	regulation of cellular component biogenesis
GO:0007186	0.761	G protein-coupled receptor signaling pathway
GO:0032098	0.752	regulation of appetite
GO:0032095	0.748	regulation of response to food
GO:1903531	0.748	negative regulation of secretion by cell
GO:0050709	0.743	negative regulation of protein secretion
GO:0048869	0.725	cellular developmental process
GO:0048584	0.695	positive regulation of response to stimulus
GO:0042127	0.690	regulation of cell population proliferation
GO:0002792	0.686	negative regulation of peptide secretion
GO:0048585	0.675	negative regulation of response to stimulus
GO:0051128	0.672	regulation of cellular component organization
GO:0032102	0.665	negative regulation of response to external stimulus
GO:0048731	0.662	system development
GO:0016043	0.660	cellular component organization
GO:0032652	0.656	regulation of interleukin-1 production
GO:0009966	0.628	regulation of signal transduction
GO:0046879	0.616	hormone secretion
GO:0032368	0.609	regulation of lipid transport
GO:1905954	0.607	positive regulation of lipid localization
GO:0023057	0.599	negative regulation of signaling
GO:0032692	0.594	negative regulation of interleukin-1 production
GO:0010648	0.585	negative regulation of cell communication
GO:0030154	0.583	cell differentiation
GO:0050803	0.572	regulation of synapse structure or activity
GO:0032370	0.568	positive regulation of lipid transport
GO:0050678	0.562	regulation of epithelial cell proliferation
GO:0050807	0.560	regulation of synapse organization
GO:0051130	0.554	positive regulation of cellular component organization
GO:0044060	0.550	regulation of endocrine process
GO:2000026	0.538	regulation of multicellular organismal development
GO:2000831	0.535	regulation of steroid hormone secretion
GO:2000833	0.533	positive regulation of steroid hormone secretion
GO:0048468	0.486	cell development
GO:0042221	0.483	response to chemical
GO:0044089	0.478	positive regulation of cellular component biogenesis
GO:0071310	0.355	cellular response to organic substance
GO:0010604	0.313	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005622	0.997	intracellular anatomical structure
GO:0005737	0.992	cytoplasm
GO:0005615	0.971	extracellular space
GO:0043231	0.685	intracellular membrane-bounded organelle
GO:0012505	0.682	endomembrane system
GO:0070013	0.605	intracellular organelle lumen
GO:0031982	0.481	vesicle
GO:0016020	0.464	membrane
GO:0030424	0.351	axon
GO:0005783	0.304	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]