StarFunc result for job id Q9UBU8

User Input

>input (362 residues)
MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRS
EKSLKTHEDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQ
EQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVD
PTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYK
KSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAP
HLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRK
AV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60762	0.806	0.806	1.808E-57	362	0.997	0.997	P60762.pdb.gz	MO4L1_MOUSE Mortality factor 4-like protein 1 OS=Mus musculus OX=10090 GN=Morf4l1 PE=1 SV=2
2	AFDB:B3KTM8	0.544	0.566	4.969E-47	348	0.856	0.891	B3KTM8.pdb.gz	B3KTM8_HUMAN Mortality factor 4 like 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
3	AFDB:Q15014	0.486	0.609	1.250E-30	288	0.583	0.733	Q15014.pdb.gz	MO4L2_HUMAN Mortality factor 4-like protein 2 OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
4	AFDB:Q9Y0I1	0.651	0.560	1.298E-27	424	0.453	0.387	Q9Y0I1.pdb.gz	EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster OX=7227 GN=MRG15 PE=1 SV=1
5	AFDB:O13953	0.451	0.484	5.107E-23	337	0.331	0.356	O13953.pdb.gz	EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp13 PE=1 SV=1
6	AFDB:Q59K07	0.464	0.456	7.751E-20	369	0.249	0.244	Q59K07.pdb.gz	EAF3_CANAL Chromatin modification-related protein EAF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF3 PE=3 SV=1
7	AFDB:Q12432	0.466	0.421	1.749E-19	401	0.287	0.259	Q12432.pdb.gz	EAF3_YEAST Chromatin modification-related protein EAF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EAF3 PE=1 SV=1
8	AFDB:P50536	0.379	0.272	6.031E-14	512	0.265	0.188	P50536.pdb.gz	MSL3_DROME Protein male-specific lethal-3 OS=Drosophila melanogaster OX=7227 GN=msl-3 PE=1 SV=2
9	AFDB:Q8N5Y2	0.450	0.319	6.722E-14	521	0.287	0.200	Q8N5Y2.pdb.gz	MS3L1_HUMAN Male-specific lethal 3 homolog OS=Homo sapiens OX=9606 GN=MSL3 PE=1 SV=1
10	AFDB:Q9WVG9	0.429	0.303	2.342E-13	525	0.307	0.211	Q9WVG9.pdb.gz	MS3L1_MOUSE Male-specific lethal 3 homolog OS=Mus musculus OX=10090 GN=Msl3 PE=1 SV=3
11	PDB:3mp8A	0.132	0.095	6.720E-1	513	0.030	0.021	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
12	PDB:3j791	0.122	0.295	8.348E-1	140	0.022	0.057	3j791.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
13	PDB:6tnnI	0.135	0.285	9.305E-1	134	0.052	0.142	6tnnI.pdb.gz	Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
14	PDB:7pzyu	0.100	0.246	1.436	130	0.030	0.085	7pzyu.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
15	PDB:1khiA	0.086	0.202	1.516	147	0.008	0.020	1khiA.pdb.gz
16	PDB:5ikjA	0.098	0.080	1.989	448	0.019	0.016	5ikjA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
17	PDB:4cbxA	0.082	0.082	2.217	358	0.072	0.073	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
18	PDB:1m5yD	0.092	0.087	2.609	389	0.047	0.044	1m5yD.pdb.gz
19	PDB:4v8mBU	0.113	0.219	2.609	158	0.077	0.177	4v8mBU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
20	PDB:7z37DP1	0.083	0.103	2.754	273	0.061	0.081	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3KTM8	0.0	624	348	0.854	0.888	B3KTM8_HUMAN Mortality factor 4 like 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
2	P60762	0.0	746	362	0.997	0.997	MO4L1_MOUSE Mortality factor 4-like protein 1 OS=Mus musculus OX=10090 GN=Morf4l1 PE=1 SV=2
3	Q9UBU8	0.0	749	362	1.000	1.000	MO4L1_HUMAN Mortality factor 4-like protein 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=2
4	H0YMJ0	1.09e-156	441	245	0.610	0.902	H0YMJ0_HUMAN Mortality factor 4 like 1 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
5	H0YNE0	4.19e-153	431	213	0.583	0.991	H0YNE0_HUMAN Mortality factor 4 like 1 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
6	Q15014	7.00e-147	418	288	0.572	0.719	MO4L2_HUMAN Mortality factor 4-like protein 2 OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
7	Q6QI89	2.29e-143	409	288	0.555	0.698	MO4L2_RAT Mortality factor 4-like protein 2 OS=Rattus norvegicus OX=10116 GN=Morf4l2 PE=2 SV=1
8	Q9Y0I1	1.82e-82	259	424	0.448	0.382	EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster OX=7227 GN=MRG15 PE=1 SV=1
9	Q5JXX2	9.07e-66	207	177	0.287	0.588	Q5JXX2_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
10	O13953	2.30e-55	186	337	0.340	0.365	EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp13 PE=1 SV=1
11	Q5JXX1	3.67e-54	177	158	0.246	0.563	Q5JXX1_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
12	Q94C32	9.18e-51	174	320	0.307	0.347	MRG1_ARATH Protein MRG1 OS=Arabidopsis thaliana OX=3702 GN=MRG1 PE=1 SV=1
13	Q4V3E2	2.05e-38	141	327	0.293	0.324	MRG2_ARATH Protein MRG2 OS=Arabidopsis thaliana OX=3702 GN=MRG2 PE=1 SV=1
14	Q12432	2.52e-34	132	401	0.293	0.264	EAF3_YEAST Chromatin modification-related protein EAF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EAF3 PE=1 SV=1
15	Q59K07	8.62e-31	122	369	0.260	0.255	EAF3_CANAL Chromatin modification-related protein EAF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF3 PE=3 SV=1
16	A7DTF0	2.15e-19	90.1	337	0.262	0.282	MRG1_CAEEL Mortality factor related protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrg-1 PE=1 SV=1
17	Q8N5Y2	1.28e-14	77.0	521	0.227	0.157	MS3L1_HUMAN Male-specific lethal 3 homolog OS=Homo sapiens OX=9606 GN=MSL3 PE=1 SV=1
18	Q9WVG9	1.61e-14	77.0	525	0.235	0.162	MS3L1_MOUSE Male-specific lethal 3 homolog OS=Mus musculus OX=10090 GN=Msl3 PE=1 SV=3
19	P50536	0.002	42.7	512	0.052	0.037	MSL3_DROME Protein male-specific lethal-3 OS=Drosophila melanogaster OX=7227 GN=msl-3 PE=1 SV=2
20	Q5JXX6	0.20	33.1	67	0.041	0.224	Q5JXX6_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05712 MRG	1.1e-49	180.1	MRG
2	PF11717 Tudor-knot	2.2e-06	38.8	RNA binding activity-knot of a chromodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000010671

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003880	0.996	PHD finger protein 12
2	61853.ENSNLEP00000012065	0.995	MRG/MORF4L binding protein
3	61853.ENSNLEP00000007058	0.994	K(lysine) acetyltransferase 5
4	61853.ENSNLEP00000004637	0.991	YEATS domain containing 4
5	61853.ENSNLEP00000016981	0.990	DNA methyltransferase 1 associated protein 1
6	61853.ENSNLEP00000014063	0.988	MYST/Esa1-associated factor 6
7	61853.ENSNLEP00000005920	0.986	RuvB-like helicase
8	61853.ENSNLEP00000014397	0.985	Inhibitor of growth family, member 3
9	61853.ENSNLEP00000017307	0.985	RuvB-like helicase
10	61853.ENSNLEP00000022030	0.983	Enhancer of polycomb homolog 1 (Drosophila)
11	61853.ENSNLEP00000006781	0.982	SIN3 transcription regulator family member B
12	61853.ENSNLEP00000011131	0.980	Enhancer of polycomb homolog 2 (Drosophila)
13	61853.ENSNLEP00000015855	0.980	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
14	61853.ENSNLEP00000016148	0.979	SIN3 transcription regulator family member A
15	61853.ENSNLEP00000019626	0.977	K(lysine) acetyltransferase 8
16	61853.ENSNLEP00000010657	0.976	Bromodomain containing 8
17	61853.ENSNLEP00000007056	0.975	Actin-like 6A
18	61853.ENSNLEP00000010409	0.973	E1A binding protein p400
19	61853.ENSNLEP00000014469	0.968	Actin-like 6B
20	61853.ENSNLEP00000011707	0.964	Histone deacetylase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.988	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0019219	0.989	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.983	positive regulation of cellular process
GO:0043170	0.981	macromolecule metabolic process
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0045935	0.974	positive regulation of nucleobase-containing compound metabolic process
GO:0016570	0.965	histone modification
GO:2001020	0.964	regulation of response to DNA damage stimulus
GO:0018205	0.959	peptidyl-lysine modification
GO:0051054	0.948	positive regulation of DNA metabolic process
GO:0006282	0.944	regulation of DNA repair
GO:0016573	0.941	histone acetylation
GO:2001022	0.936	positive regulation of response to DNA damage stimulus
GO:0000018	0.935	regulation of DNA recombination
GO:2000779	0.934	regulation of double-strand break repair
GO:0045739	0.922	positive regulation of DNA repair
GO:0010569	0.921	regulation of double-strand break repair via homologous recombination
GO:0043967	0.915	histone H4 acetylation
GO:0044237	0.883	cellular metabolic process
GO:0006338	0.843	chromatin remodeling
GO:0050896	0.822	response to stimulus
GO:0045911	0.812	positive regulation of DNA recombination
GO:2000781	0.810	positive regulation of double-strand break repair
GO:1901360	0.806	organic cyclic compound metabolic process
GO:0034641	0.806	cellular nitrogen compound metabolic process
GO:0051716	0.802	cellular response to stimulus
GO:0006725	0.797	cellular aromatic compound metabolic process
GO:0090304	0.792	nucleic acid metabolic process
GO:0006950	0.777	response to stress
GO:0006974	0.768	cellular response to DNA damage stimulus
GO:0044260	0.759	cellular macromolecule metabolic process
GO:0006259	0.712	DNA metabolic process
GO:0006302	0.696	double-strand break repair
GO:0010468	0.623	regulation of gene expression
GO:0008283	0.595	cell population proliferation
GO:0006310	0.550	DNA recombination
GO:0009889	0.508	regulation of biosynthetic process
GO:0048144	0.504	fibroblast proliferation
GO:0051252	0.477	regulation of RNA metabolic process
GO:0031326	0.475	regulation of cellular biosynthetic process
GO:0010556	0.469	regulation of macromolecule biosynthetic process
GO:0051726	0.468	regulation of cell cycle
GO:0006355	0.413	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.975	protein-containing complex
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:0016604	0.964	nuclear body
GO:0016607	0.952	nuclear speck
GO:0140513	0.925	nuclear protein-containing complex
GO:0005694	0.828	chromosome
GO:1902494	0.818	catalytic complex
GO:0000785	0.818	chromatin
GO:1990234	0.807	transferase complex
GO:0140535	0.801	intracellular protein-containing complex
GO:1902562	0.663	H4 histone acetyltransferase complex
GO:0043189	0.552	H4/H2A histone acetyltransferase complex
GO:0035267	0.541	NuA4 histone acetyltransferase complex
GO:0032993	0.522	protein-DNA complex
GO:0044815	0.500	DNA packaging complex
GO:0000786	0.492	nucleosome
GO:0000118	0.460	histone deacetylase complex
GO:0000228	0.453	nuclear chromosome
GO:0005737	0.377	cytoplasm
GO:0070822	0.347	Sin3-type complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]