StarFunc result for job id Q9UBV4

User Input

>input (365 residues)
MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKET
AFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSR
KFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
SFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKL
GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
VHTCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBV4	1.000	1.000	1.544E-65	365	1.000	1.000	Q9UBV4.pdb.gz	WNT16_HUMAN Protein Wnt-16 OS=Homo sapiens OX=9606 GN=WNT16 PE=2 SV=1
2	AFDB:A5WVL3	0.903	0.925	8.484E-50	356	0.647	0.663	A5WVL3.pdb.gz	A5WVL3_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:77293 PE=3 SV=1
3	AFDB:Q3L248	0.641	0.931	7.128E-37	248	0.584	0.859	Q3L248.pdb.gz	Q3L248_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT16 PE=2 SV=1
4	AFDB:P49337	0.838	0.869	5.219E-36	351	0.408	0.425	P49337.pdb.gz	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
5	AFDB:P22724	0.850	0.883	3.278E-35	351	0.400	0.416	P22724.pdb.gz	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
6	AFDB:P47793	0.816	0.845	1.957E-34	352	0.411	0.426	P47793.pdb.gz	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
7	AFDB:A1BPR0	0.830	0.811	3.610E-34	374	0.400	0.390	A1BPR0.pdb.gz	A1BPR0_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt5a PE=2 SV=1
8	AFDB:Q93097	0.786	0.736	9.523E-34	391	0.408	0.381	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
9	AFDB:P10108	0.797	0.785	2.048E-33	371	0.395	0.388	P10108.pdb.gz	WNT1_XENLA Protein Wnt-1 OS=Xenopus laevis OX=8355 GN=wnt1 PE=2 SV=1
10	AFDB:P31286	0.828	0.797	2.268E-33	380	0.392	0.376	P31286.pdb.gz	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
11	PDB:6ahyB	0.719	0.830	7.078E-28	313	0.370	0.431	6ahyB.pdb.gz
12	PDB:4f0aB	0.639	0.780	7.285E-24	294	0.301	0.374	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7d3sR	0.128	0.148	9.168E-1	266	0.060	0.083	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
14	PDB:6wlw0	0.097	0.148	1.245	204	0.093	0.167	6wlw0.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
15	PDB:1ek9A	0.084	0.072	1.379	428	0.068	0.058	1ek9A.pdb.gz
16	PDB:7taoD	0.092	0.171	1.692	158	0.071	0.165	7taoD.pdb.gz	Cryo-EM of the Yeast V O Complex Reveals Distinct Binding Sites for Macrolide V-ATPase Inhibitors.
17	PDB:7l08c	0.093	0.111	2.075	289	0.110	0.138	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
18	PDB:5voxR	0.094	0.129	2.184	213	0.068	0.117	5voxR.pdb.gz
19	PDB:7c7sA	0.118	0.082	2.418	685	0.047	0.025	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
20	PDB:6sb3A	0.078	0.049	2.545	604	0.022	0.013	6sb3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5WVL3	0.0	525	356	0.655	0.671	A5WVL3_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:77293 PE=3 SV=1
2	Q9QYS1	0.0	693	364	0.907	0.909	WNT16_MOUSE Protein Wnt-16 OS=Mus musculus OX=10090 GN=Wnt16 PE=2 SV=2
3	Q9UBV4	0.0	761	365	1.000	1.000	WNT16_HUMAN Protein Wnt-16 OS=Homo sapiens OX=9606 GN=WNT16 PE=2 SV=1
4	Q3L248	6.27e-156	439	248	0.586	0.863	Q3L248_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT16 PE=2 SV=1
5	A0A2R8S090	6.14e-133	381	239	0.460	0.703	A0A2R8S090_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:77293 PE=3 SV=1
6	P49338	5.72e-105	314	351	0.416	0.433	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
7	A0A0G2K3B7	3.92e-104	312	353	0.438	0.453	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
8	P56706	1.14e-103	311	349	0.430	0.450	WNT7B_HUMAN Protein Wnt-7b OS=Homo sapiens OX=9606 GN=WNT7B PE=1 SV=2
9	P28047	1.24e-103	311	349	0.430	0.450	WNT7B_MOUSE Protein Wnt-7b OS=Mus musculus OX=10090 GN=Wnt7b PE=1 SV=1
10	Q5NSW6	1.24e-103	311	349	0.430	0.450	Q5NSW6_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=2 SV=1
11	P49337	1.51e-103	310	351	0.419	0.436	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
12	P56705	2.02e-103	310	351	0.414	0.430	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
13	Q3L254	6.99e-103	309	349	0.425	0.444	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
14	Q9QXQ5	9.89e-103	308	351	0.411	0.427	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
15	P22724	1.72e-102	308	351	0.411	0.427	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
16	Q9DEB8	2.29e-101	305	349	0.411	0.430	Q9DEB8_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT7A PE=2 SV=1
17	P47793	1.42e-100	303	352	0.411	0.426	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
18	M0R9D3	1.45e-99	300	349	0.408	0.427	M0R9D3_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7a PE=3 SV=1
19	P24383	1.73e-99	300	349	0.408	0.427	WNT7A_MOUSE Protein Wnt-7a OS=Mus musculus OX=10090 GN=Wnt7a PE=1 SV=2
20	O00755	2.19e-99	300	349	0.408	0.427	WNT7A_HUMAN Protein Wnt-7a OS=Homo sapiens OX=9606 GN=WNT7A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	2.9e-115	396.7	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222462

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322304	0.948	Protein-serine O-palmitoleoyltransferase porcupine
2	9606.ENSP00000346829	0.945	Protein wntless homolog
3	9606.ENSP00000294304	0.939	Low-density lipoprotein receptor-related protein 5
4	9606.ENSP00000264634	0.930	Protein Wnt-5a
5	9606.ENSP00000325526	0.926	Protein Wnt-11
6	9606.ENSP00000272164	0.913	Protein Wnt-9a
7	9606.ENSP00000301061	0.912	Protein Wnt-10b
8	9606.ENSP00000258411	0.911	Protein Wnt-10a
9	9606.ENSP00000290015	0.909	Protein Wnt-9b
10	9606.ENSP00000426653	0.909	Protein Wnt-8a
11	9606.ENSP00000233948	0.908	Protein Wnt-6
12	9606.ENSP00000340677	0.908	Protein Wnt-8b
13	9606.ENSP00000265441	0.907	Protein Wnt-2
14	9606.ENSP00000225512	0.906	Proto-oncogene Wnt-3
15	9606.ENSP00000284523	0.906	Protein Wnt-3a
16	9606.ENSP00000290167	0.906	Protein Wnt-4
17	9606.ENSP00000358698	0.906	Protein Wnt-2b
18	9606.ENSP00000359305	0.906	Transmembrane emp24 domain-containing protein 5
19	9606.ENSP00000380379	0.906	Protein Wnt-5b
20	9606.ENSP00000293549	0.905	Proto-oncogene Wnt-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0030546	0.995	signaling receptor activator activity
GO:0048018	0.994	receptor ligand activity
GO:0001664	0.932	G protein-coupled receptor binding
GO:0005109	0.923	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0048856	0.992	anatomical structure development
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0048518	0.984	positive regulation of biological process
GO:0007275	0.970	multicellular organism development
GO:0048731	0.943	system development
GO:0048513	0.913	animal organ development
GO:0051716	0.882	cellular response to stimulus
GO:0009888	0.875	tissue development
GO:0030154	0.854	cell differentiation
GO:0009653	0.852	anatomical structure morphogenesis
GO:0048522	0.829	positive regulation of cellular process
GO:0007154	0.821	cell communication
GO:0023052	0.820	signaling
GO:0007165	0.796	signal transduction
GO:0019222	0.778	regulation of metabolic process
GO:0060255	0.745	regulation of macromolecule metabolic process
GO:0048519	0.682	negative regulation of biological process
GO:0010468	0.682	regulation of gene expression
GO:0048583	0.609	regulation of response to stimulus
GO:0007166	0.585	cell surface receptor signaling pathway
GO:0009887	0.578	animal organ morphogenesis
GO:0031323	0.577	regulation of cellular metabolic process
GO:0009893	0.575	positive regulation of metabolic process
GO:0016055	0.575	Wnt signaling pathway
GO:0051171	0.572	regulation of nitrogen compound metabolic process
GO:0080090	0.569	regulation of primary metabolic process
GO:0010604	0.565	positive regulation of macromolecule metabolic process
GO:0023051	0.518	regulation of signaling
GO:0010646	0.518	regulation of cell communication
GO:0009966	0.493	regulation of signal transduction
GO:0048523	0.476	negative regulation of cellular process
GO:0060070	0.436	canonical Wnt signaling pathway
GO:0050793	0.431	regulation of developmental process
GO:0010556	0.417	regulation of macromolecule biosynthetic process
GO:0031326	0.417	regulation of cellular biosynthetic process
GO:0051252	0.417	regulation of RNA metabolic process
GO:0006355	0.403	regulation of DNA-templated transcription
GO:0031325	0.401	positive regulation of cellular metabolic process
GO:0051173	0.363	positive regulation of nitrogen compound metabolic process
GO:0048584	0.332	positive regulation of response to stimulus
GO:0023056	0.326	positive regulation of signaling
GO:0009967	0.323	positive regulation of signal transduction
GO:0009891	0.310	positive regulation of biosynthetic process
GO:0045935	0.308	positive regulation of nucleobase-containing compound metabolic process
GO:0051239	0.305	regulation of multicellular organismal process
GO:0010557	0.304	positive regulation of macromolecule biosynthetic process
GO:0031328	0.304	positive regulation of cellular biosynthetic process
GO:0042127	0.302	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005737	0.997	cytoplasm
GO:0071944	0.851	cell periphery
GO:0043226	0.848	organelle
GO:0043227	0.839	membrane-bounded organelle
GO:0016020	0.829	membrane
GO:0005615	0.779	extracellular space
GO:0043229	0.655	intracellular organelle
GO:0005886	0.615	plasma membrane
GO:0043231	0.578	intracellular membrane-bounded organelle
GO:0070013	0.468	intracellular organelle lumen
GO:0012505	0.434	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]