StarFunc result for job id Q9UBV7

User Input

>input (327 residues)
MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARA
VRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLS
RKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEA
GPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIKGAGL
QLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTAL
SVGGAPCTVLNIMLDCDKTATPWCTFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R087	0.865	0.865	7.170E-65	327	0.920	0.920	Q8R087.pdb.gz	B4GT7_MOUSE Beta-1,4-galactosyltransferase 7 OS=Mus musculus OX=10090 GN=B4galt7 PE=2 SV=1
2	AFDB:Q8I6J0	0.719	0.730	1.053E-39	322	0.434	0.441	Q8I6J0.pdb.gz
3	AFDB:P34548	0.699	0.790	1.284E-34	289	0.367	0.415	P34548.pdb.gz	SQV3_CAEEL Xylosylprotein 4-beta-galactosyltransferase OS=Caenorhabditis elegans OX=6239 GN=sqv-3 PE=1 SV=1
4	AFDB:Q7KN92	0.582	0.476	5.393E-20	403	0.257	0.208	Q7KN92.pdb.gz	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
5	AFDB:B2RAZ5	0.588	0.560	8.266E-20	344	0.245	0.233	B2RAZ5.pdb.gz	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
6	AFDB:Q9GUM2	0.600	0.517	1.346E-19	383	0.211	0.180	Q9GUM2.pdb.gz	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
7	AFDB:A0A1S6M251	0.546	0.464	2.193E-19	388	0.232	0.196	A0A1S6M251.pdb.gz	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
8	AFDB:Q86NU9	0.563	0.620	2.331E-19	295	0.196	0.217	Q86NU9.pdb.gz	Q86NU9_DROME AT31631p OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTB PE=2 SV=1
9	AFDB:A0A384NY44	0.599	0.502	4.291E-19	393	0.205	0.170	A0A384NY44.pdb.gz	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
10	AFDB:O60909	0.588	0.520	4.291E-19	372	0.242	0.212	O60909.pdb.gz	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
11	PDB:4fixA	0.357	0.197	1.425E-4	629	0.086	0.045	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
12	PDB:4d0tA	0.374	0.255	1.066E-3	496	0.098	0.065	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
13	PDB:4d11C	0.352	0.270	1.447E-3	436	0.104	0.078	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
14	PDB:6fxrA	0.290	0.154	2.086E-3	700	0.080	0.037	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
15	PDB:7x8kB	0.275	0.251	2.086E-3	367	0.098	0.087	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
16	PDB:6h0bB	0.380	0.245	2.663E-3	521	0.080	0.050	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
17	PDB:4y63A	0.278	0.314	3.008E-3	282	0.083	0.096	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
18	PDB:1ll0B	0.232	0.275	3.612E-3	267	0.052	0.064	1ll0B.pdb.gz
19	PDB:6pxuB	0.355	0.231	4.610E-3	532	0.083	0.051	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
20	PDB:2xwnB	0.262	0.356	4.900E-3	227	0.070	0.101	2xwnB.pdb.gz	Structural and Functional Studies on Mycobacterial Ispd Enzymes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R087	0.0	567	327	0.920	0.920	B4GT7_MOUSE Beta-1,4-galactosyltransferase 7 OS=Mus musculus OX=10090 GN=B4galt7 PE=2 SV=1
2	Q9UBV7	0.0	680	327	1.000	1.000	B4GT7_HUMAN Beta-1,4-galactosyltransferase 7 OS=Homo sapiens OX=9606 GN=B4GALT7 PE=1 SV=1
3	Q9VBZ9	7.98e-89	270	322	0.462	0.469	B4GT7_DROME Beta-1,4-galactosyltransferase 7 OS=Drosophila melanogaster OX=7227 GN=beta4GalT7 PE=1 SV=1
4	P34548	7.16e-73	228	289	0.352	0.398	SQV3_CAEEL Xylosylprotein 4-beta-galactosyltransferase OS=Caenorhabditis elegans OX=6239 GN=sqv-3 PE=1 SV=1
5	P08037	1.22e-33	129	402	0.226	0.184	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
6	P15291	3.21e-33	128	398	0.223	0.183	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
7	Q99PC2	3.39e-33	128	393	0.223	0.186	Q99PC2_CRIGR Beta-1,4-galactosyltransferase OS=Cricetulus griseus OX=10029 GN=beta4GalT-1 PE=2 SV=1
8	P15535	7.26e-33	127	399	0.220	0.180	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
9	Q7KN92	8.48e-33	127	403	0.226	0.184	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
10	A0A1S6M251	9.25e-30	119	388	0.223	0.188	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
11	Q9JMK0	1.36e-29	118	388	0.223	0.188	B4GT5_MOUSE Beta-1,4-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B4galt5 PE=1 SV=2
12	Q9UBX8	1.70e-29	118	382	0.232	0.199	B4GT6_HUMAN Beta-1,4-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B4GALT6 PE=1 SV=1
13	O43286	2.21e-29	117	388	0.223	0.188	B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B4GALT5 PE=1 SV=1
14	Q9WVK5	2.88e-28	114	382	0.229	0.196	B4GT6_MOUSE Beta-1,4-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B4galt6 PE=1 SV=1
15	Q802Y5	3.21e-28	114	381	0.214	0.184	Q802Y5_DANRE Beta-1,4-galactosyltransferase OS=Danio rerio OX=7955 GN=zgc:55730 PE=2 SV=1
16	O88419	5.39e-28	114	382	0.226	0.194	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1
17	O60909	1.42e-26	110	372	0.199	0.175	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
18	B2RAZ5	1.75e-26	109	344	0.214	0.203	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
19	O60513	1.75e-26	109	344	0.214	0.203	B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1
20	A0A384NY44	2.60e-26	109	393	0.217	0.181	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10111 Glyco_tranf_2_2	18	16.3	Glycosyltransferase like family 2
2	PF02709 Glyco_transf_7C	2e-22	90.0	N-terminal domain of galactosyltransferase
3	PF13733 Glyco_transf_7N	1.9e-18	77.8	N-terminal region of glycosyl transferase group 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000029410

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368496	0.994	Beta-1,3-galactosyltransferase 6
2	9606.ENSP00000017003	0.984	Xylosyltransferase 2
3	9606.ENSP00000261381	0.983	Xylosyltransferase 1
4	9606.ENSP00000052754	0.938	Decorin
5	9606.ENSP00000292377	0.932	Glypican-2
6	9606.ENSP00000327336	0.929	Biglycan
7	9606.ENSP00000366267	0.928	Glypican-5
8	9606.ENSP00000359864	0.927	Glypican-4
9	9606.ENSP00000264039	0.926	Glypican-1
10	9606.ENSP00000366246	0.922	Glypican-6
11	9606.ENSP00000377836	0.922	Glypican-3
12	9606.ENSP00000265471	0.921	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
13	9606.ENSP00000307046	0.921	Syndecan-2
14	9606.ENSP00000344468	0.919	Syndecan-3
15	9606.ENSP00000363827	0.919	Basement membrane-specific heparan sulfate proteoglycan core protein
16	9606.ENSP00000370542	0.918	Syndecan-1
17	9606.ENSP00000368678	0.916	Agrin
18	9606.ENSP00000265077	0.914	Versican core protein
19	9606.ENSP00000361818	0.911	Syndecan-4
20	9606.ENSP00000331210	0.906	Brevican core protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140103	0.999	catalytic activity, acting on a glycoprotein
GO:0035250	0.999	UDP-galactosyltransferase activity
GO:0005488	0.882	binding
GO:0005515	0.873	protein binding
GO:0046525	0.816	xylosylprotein 4-beta-galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901137	0.992	carbohydrate derivative biosynthetic process
GO:1901566	0.992	organonitrogen compound biosynthetic process
GO:0030203	0.987	glycosaminoglycan metabolic process
GO:0009987	0.971	cellular process
GO:0006023	0.966	aminoglycan biosynthetic process
GO:0006024	0.957	glycosaminoglycan biosynthetic process
GO:0044238	0.954	primary metabolic process
GO:0044237	0.862	cellular metabolic process
GO:0044249	0.830	cellular biosynthetic process
GO:0019538	0.812	protein metabolic process
GO:0009100	0.785	glycoprotein metabolic process
GO:0009101	0.781	glycoprotein biosynthetic process
GO:0006029	0.464	proteoglycan metabolic process
GO:0065007	0.380	biological regulation
GO:0050789	0.358	regulation of biological process
GO:0050794	0.318	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.997	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	0.999	Hexosyltransferases.
RHEA:15297	0.816	3-O-(beta-D-xylosyl)-L-seryl-[protein] + UDP-alpha-D-galactose = 3-O-(beta-D-galactosyl-(1->4)-beta-D-xylosyl)-L-seryl-[protein] + H(+) + UDP
EC:2.4.1.133	0.816	xylosylprotein 4-beta-galactosyltransferase.

[back to server]