StarFunc result for job id Q9UBV8

User Input

>input (284 residues)
MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAG
GGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAY
SWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALW
KFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQL
DRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBV8	1.000	1.000	3.523E-44	284	1.000	1.000	Q9UBV8.pdb.gz	PEF1_HUMAN Peflin OS=Homo sapiens OX=9606 GN=PEF1 PE=1 SV=1
2	AFDB:Q5PQ53	0.681	0.684	1.482E-30	283	0.694	0.696	Q5PQ53.pdb.gz	PEF1_XENLA Peflin OS=Xenopus laevis OX=8355 GN=pef1 PE=1 SV=1
3	AFDB:Q7K2L7	0.581	0.821	6.238E-17	199	0.282	0.402	Q7K2L7.pdb.gz	Q7K2L7_DROME GH27120p OS=Drosophila melanogaster OX=7227 GN=Pef PE=1 SV=1
4	AFDB:A8Y589	0.556	0.871	4.845E-15	178	0.246	0.393	A8Y589.pdb.gz	A8Y589_DROME Apoptosis-linked gene-2 OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=1 SV=2
5	AFDB:O75340	0.550	0.805	2.957E-14	191	0.246	0.366	O75340.pdb.gz	PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1
6	AFDB:Q2QY10	0.517	0.505	4.917E-14	292	0.370	0.360	Q2QY10.pdb.gz	CBP_ORYSJ Calcium-binding protein CBP OS=Oryza sativa subsp. japonica OX=39947 GN=CBP PE=2 SV=1
7	PDB:1hqvA	0.538	0.839	1.229E-13	178	0.257	0.410	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
8	AFDB:Q8SYT2	0.484	0.620	8.784E-13	219	0.222	0.288	Q8SYT2.pdb.gz	Q8SYT2_DROME RE34768p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=2 SV=2
9	AFDB:P28676	0.472	0.594	2.430E-12	217	0.229	0.300	P28676.pdb.gz	GRAN_HUMAN Grancalcin OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=2
10	AFDB:P53238	0.524	0.449	3.819E-12	335	0.218	0.185	P53238.pdb.gz	PEF1_YEAST Peflin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEF1 PE=1 SV=2
11	PDB:4uslA	0.500	0.788	4.089E-12	173	0.208	0.341	4uslA.pdb.gz	Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
12	AFDB:Q8VC88	0.462	0.573	4.788E-12	220	0.229	0.295	Q8VC88.pdb.gz	GRAN_MOUSE Grancalcin OS=Mus musculus OX=10090 GN=Gca PE=1 SV=1
13	PDB:1kfuL	0.443	0.203	3.411E-9	699	0.155	0.063	1kfuL.pdb.gz
14	PDB:1kfxL	0.445	0.219	7.638E-8	640	0.155	0.069	1kfxL.pdb.gz
15	PDB:3qrxA	0.206	0.391	1.152E-6	145	0.130	0.255	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
16	PDB:5a2hA	0.211	0.381	3.774E-6	147	0.109	0.211	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
17	PDB:5d43A	0.232	0.399	5.605E-6	150	0.120	0.227	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
18	PDB:3fwbA	0.206	0.359	7.436E-6	153	0.102	0.190	3fwbA.pdb.gz
19	PDB:6hr1A	0.211	0.154	1.237E-5	406	0.102	0.071	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
20	PDB:2f2pA	0.223	0.357	1.736E-5	169	0.113	0.189	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBV8	0.0	572	284	1.000	1.000	PEF1_HUMAN Peflin OS=Homo sapiens OX=9606 GN=PEF1 PE=1 SV=1
2	Q5PQ53	1.16e-122	353	283	0.687	0.689	PEF1_XENLA Peflin OS=Xenopus laevis OX=8355 GN=pef1 PE=1 SV=1
3	Q7K2L7	8.99e-47	157	199	0.264	0.377	Q7K2L7_DROME GH27120p OS=Drosophila melanogaster OX=7227 GN=Pef PE=1 SV=1
4	Q2QY10	1.61e-42	149	292	0.306	0.298	CBP_ORYSJ Calcium-binding protein CBP OS=Oryza sativa subsp. japonica OX=39947 GN=CBP PE=2 SV=1
5	A8Y589	2.27e-41	142	178	0.261	0.416	A8Y589_DROME Apoptosis-linked gene-2 OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=1 SV=2
6	P12815	1.17e-37	133	191	0.250	0.372	PDCD6_MOUSE Programmed cell death protein 6 OS=Mus musculus OX=10090 GN=Pdcd6 PE=1 SV=2
7	O75340	2.03e-37	133	191	0.250	0.372	PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1
8	Q8SYT2	9.94e-32	119	219	0.218	0.283	Q8SYT2_DROME RE34768p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=2 SV=2
9	Q8VC88	7.70e-30	114	220	0.243	0.314	GRAN_MOUSE Grancalcin OS=Mus musculus OX=10090 GN=Gca PE=1 SV=1
10	P28676	1.01e-29	114	217	0.232	0.304	GRAN_HUMAN Grancalcin OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=2
11	P30626	3.69e-29	111	198	0.208	0.298	SORCN_HUMAN Sorcin OS=Homo sapiens OX=9606 GN=SRI PE=1 SV=1
12	A0A8I5Y9M9	1.28e-28	111	235	0.197	0.238	A0A8I5Y9M9_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
13	A0A8I5ZWU9	1.42e-28	109	183	0.197	0.306	A0A8I5ZWU9_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
14	H7BXD5	1.43e-28	110	198	0.197	0.283	H7BXD5_HUMAN Grancalcin OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=1
15	A0A8I5ZTT7	1.50e-28	109	182	0.197	0.308	A0A8I5ZTT7_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
16	P05044	2.20e-28	109	198	0.201	0.288	SORCN_CRIGR Sorcin OS=Cricetulus griseus OX=10029 GN=SRI PE=1 SV=1
17	A0A8I6AU02	7.40e-28	108	203	0.197	0.276	A0A8I6AU02_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
18	Q6P069	1.01e-27	108	198	0.197	0.283	SORCN_MOUSE Sorcin OS=Mus musculus OX=10090 GN=Sri PE=1 SV=1
19	B0BNJ1	1.19e-27	107	198	0.197	0.283	B0BNJ1_RAT LOC683667 protein OS=Rattus norvegicus OX=10116 GN=Sri PE=2 SV=1
20	H7C2Z6	5.81e-23	94.0	146	0.162	0.315	H7C2Z6_HUMAN Grancalcin (Fragment) OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	4.1e-14	62.0	EF hand
2	PF13202 EF-hand_5	1.3e-11	54.6	EF hand
3	PF13405 EF-hand_6	1.1e-13	60.8	EF-hand domain
4	PF13499 EF-hand_7	8.4e-14	63.1	EF-hand domain pair
5	PF13833 EF-hand_8	0.00046	31.2	EF-hand domain pair
6	PF14658 EF-hand_9	7.3	18.4	EF-hand domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002455

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013136	0.985	Programmed cell death 6
2	61853.ENSNLEP00000021992	0.969	Kelch-like family member 12
3	61853.ENSNLEP00000010880	0.966	SEC31 homolog A, COPII coat complex component
4	61853.ENSNLEP00000005468	0.942	SEC13 homolog, nuclear pore and COPII coat complex component
5	61853.ENSNLEP00000010923	0.899	SEC24 homolog D, COPII coat complex component
6	61853.ENSNLEP00000020303	0.892	SEC24 homolog C, COPII coat complex component
7	61853.ENSNLEP00000009943	0.887	SEC24 homolog A, COPII coat complex component
8	61853.ENSNLEP00000013690	0.887	Secretion associated, Ras related GTPase 1A
9	61853.ENSNLEP00000004844	0.875	Sec23 homolog A, coat complex II component
10	61853.ENSNLEP00000011891	0.867	Cullin 3
11	61853.ENSNLEP00000020174	0.863	SEC24 homolog B, COPII coat complex component
12	61853.ENSNLEP00000017958	0.838	SEC31 homolog B, COPII coat complex component
13	61853.ENSNLEP00000014309	0.831	Uncharacterized protein
14	61853.ENSNLEP00000010376	0.795	Kelch-like family member 3
15	61853.ENSNLEP00000007905	0.756	Kelch-like family member 2
16	61853.ENSNLEP00000011959	0.756	Sec23 homolog B, coat complex II component
17	61853.ENSNLEP00000009909	0.723	Secretion associated, Ras related GTPase 1B
18	61853.ENSNLEP00000009181	0.697	Kelch repeat and BTB (POZ) domain containing 8
19	61853.ENSNLEP00000014865	0.695	Kelch-like ECH-associated protein 1
20	61853.ENSNLEP00000005892	0.689	Kelch-like family member 41

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	0.983	calcium ion binding
GO:0042802	0.888	identical protein binding
GO:0048306	0.772	calcium-dependent protein binding
GO:0046983	0.732	protein dimerization activity
GO:1901363	0.720	heterocyclic compound binding
GO:0097159	0.720	organic cyclic compound binding
GO:0003676	0.712	nucleic acid binding
GO:1990756	0.711	ubiquitin ligase-substrate adaptor activity
GO:0046982	0.698	protein heterodimerization activity
GO:0003723	0.681	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.988	regulation of biological process
GO:0016050	0.954	vesicle organization
GO:0061024	0.949	membrane organization
GO:0051649	0.948	establishment of localization in cell
GO:0016192	0.942	vesicle-mediated transport
GO:0006900	0.915	vesicle budding from membrane
GO:0019222	0.913	regulation of metabolic process
GO:0050896	0.892	response to stimulus
GO:0032502	0.860	developmental process
GO:0048856	0.847	anatomical structure development
GO:0060255	0.805	regulation of macromolecule metabolic process
GO:0080090	0.802	regulation of primary metabolic process
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0048518	0.786	positive regulation of biological process
GO:0051246	0.778	regulation of protein metabolic process
GO:1903320	0.754	regulation of protein modification by small protein conjugation or removal
GO:0048762	0.750	mesenchymal cell differentiation
GO:0048863	0.749	stem cell differentiation
GO:0048193	0.738	Golgi vesicle transport
GO:0006888	0.718	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0014033	0.717	neural crest cell differentiation
GO:0051640	0.612	organelle localization
GO:0050794	0.590	regulation of cellular process
GO:0048864	0.527	stem cell development
GO:0032501	0.398	multicellular organismal process
GO:0008152	0.376	metabolic process
GO:0044085	0.341	cellular component biogenesis
GO:0014032	0.332	neural crest cell development
GO:1903322	0.331	positive regulation of protein modification by small protein conjugation or removal
GO:0071704	0.330	organic substance metabolic process
GO:0031396	0.330	regulation of protein ubiquitination
GO:0051648	0.329	vesicle localization
GO:0007275	0.323	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0032991	0.994	protein-containing complex
GO:0030659	0.987	cytoplasmic vesicle membrane
GO:0098588	0.979	bounding membrane of organelle
GO:0005576	0.978	extracellular region
GO:0030135	0.976	coated vesicle
GO:0030133	0.976	transport vesicle
GO:0030658	0.974	transport vesicle membrane
GO:0005829	0.971	cytosol
GO:0140535	0.955	intracellular protein-containing complex
GO:1990234	0.955	transferase complex
GO:0000151	0.946	ubiquitin ligase complex
GO:0031463	0.944	Cul3-RING ubiquitin ligase complex
GO:0030662	0.940	coated vesicle membrane
GO:0043230	0.936	extracellular organelle
GO:0005615	0.931	extracellular space
GO:1903561	0.928	extracellular vesicle
GO:0048475	0.927	coated membrane
GO:0098796	0.917	membrane protein complex
GO:0012507	0.916	ER to Golgi transport vesicle membrane
GO:0030120	0.907	vesicle coat
GO:0030127	0.853	COPII vesicle coat
GO:0070013	0.776	intracellular organelle lumen
GO:0005634	0.764	nucleus
GO:0005783	0.732	endoplasmic reticulum
GO:0070062	0.706	extracellular exosome
GO:0031981	0.671	nuclear lumen
GO:0005654	0.394	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]