StarFunc result for job id Q9UBX0

User Input

>input (185 residues)
MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCL
HVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQI
EVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFN
TNLLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBX0	1.000	1.000	8.039E-30	185	1.000	1.000	Q9UBX0.pdb.gz	HESX1_HUMAN Homeobox expressed in ES cells 1 OS=Homo sapiens OX=9606 GN=HESX1 PE=1 SV=1
2	AFDB:Q61658	0.614	0.614	4.356E-22	185	0.773	0.773	Q61658.pdb.gz	HESX1_MOUSE Homeobox expressed in ES cells 1 OS=Mus musculus OX=10090 GN=Hesx1 PE=2 SV=2
3	AFDB:Q91898	0.528	0.523	1.272E-17	187	0.578	0.572	Q91898.pdb.gz	HESXB_XENLA Homeobox expressed in ES cells 1-B OS=Xenopus laevis OX=8355 GN=hesx1-b PE=1 SV=2
4	AFDB:B3DGX6	0.481	0.545	4.541E-13	161	0.459	0.528	B3DGX6.pdb.gz
5	AFDB:P56915	0.382	0.284	7.240E-9	257	0.292	0.210	P56915.pdb.gz	GSC_HUMAN Homeobox protein goosecoid OS=Homo sapiens OX=9606 GN=GSC PE=1 SV=2
6	AFDB:P53544	0.379	0.299	9.306E-8	240	0.314	0.242	P53544.pdb.gz	GSC_DANRE Homeobox protein goosecoid OS=Danio rerio OX=7955 GN=gsc PE=2 SV=1
7	AFDB:Q6P295	0.343	0.261	4.365E-7	245	0.276	0.208	Q6P295.pdb.gz	Q6P295_DANRE Paired mesoderm homeobox protein 1 OS=Danio rerio OX=7955 GN=fa97b09 PE=2 SV=1
8	AFDB:P54821	0.344	0.262	6.109E-7	245	0.297	0.224	P54821.pdb.gz	PRRX1_HUMAN Paired mesoderm homeobox protein 1 OS=Homo sapiens OX=9606 GN=PRRX1 PE=1 SV=2
9	AFDB:Q04896	0.337	0.274	1.368E-6	231	0.270	0.216	Q04896.pdb.gz	HME1A_DANRE Homeobox protein engrailed-1a OS=Danio rerio OX=7955 GN=eng1a PE=2 SV=1
10	AFDB:Q7T373	0.343	0.262	1.674E-6	245	0.276	0.208	Q7T373.pdb.gz	Q7T373_DANRE Paired related homeobox 1 OS=Danio rerio OX=7955 GN=prrx1 PE=2 SV=1
11	PDB:4egcA	0.267	0.092	1.482E-2	539	0.097	0.033	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.270	0.608	4.342E-2	73	0.103	0.260	2hi3A.pdb.gz
13	PDB:7b93E	0.164	0.143	8.932E-1	215	0.054	0.047	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
14	PDB:5x6cA	0.124	0.051	1.250	539	0.049	0.017	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
15	PDB:7awtE	0.181	0.211	1.529	156	0.059	0.071	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
16	PDB:4ldzA	0.185	0.177	1.871	196	0.092	0.087	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
17	PDB:4zzlA	0.149	0.181	2.140	146	0.076	0.096	4zzlA.pdb.gz
18	PDB:8ap8h	0.185	0.232	2.618	137	0.086	0.117	8ap8h.pdb.gz
19	PDB:3kloA	0.167	0.144	2.994	217	0.059	0.051	3kloA.pdb.gz	Vibrio cholerae VpsT Regulates Matrix Production and Motility by Directly Sensing Cyclic di-GMP.
20	PDB:7fbyA	0.194	0.228	2.994	153	0.032	0.039	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UBX0	6.70e-139	386	185	1.000	1.000	HESX1_HUMAN Homeobox expressed in ES cells 1 OS=Homo sapiens OX=9606 GN=HESX1 PE=1 SV=1
2	Q61658	5.65e-107	305	185	0.805	0.805	HESX1_MOUSE Homeobox expressed in ES cells 1 OS=Mus musculus OX=10090 GN=Hesx1 PE=2 SV=2
3	Q91898	1.47e-68	208	187	0.578	0.572	HESXB_XENLA Homeobox expressed in ES cells 1-B OS=Xenopus laevis OX=8355 GN=hesx1-b PE=1 SV=2
4	P79738	4.76e-44	145	161	0.459	0.528	P79738_DANRE Homeobox expressed in ES cells 1 OS=Danio rerio OX=7955 GN=DANF PE=2 SV=1
5	Q02591	5.98e-18	80.9	256	0.249	0.180	GSC_MOUSE Homeobox protein goosecoid OS=Mus musculus OX=10090 GN=Gsc PE=1 SV=1
6	P56915	6.07e-18	80.9	257	0.249	0.179	GSC_HUMAN Homeobox protein goosecoid OS=Homo sapiens OX=9606 GN=GSC PE=1 SV=2
7	P53544	3.34e-17	78.6	240	0.249	0.192	GSC_DANRE Homeobox protein goosecoid OS=Danio rerio OX=7955 GN=gsc PE=2 SV=1
8	Q8N693	9.88e-17	79.0	406	0.222	0.101	ESX1_HUMAN Homeobox protein ESX1 OS=Homo sapiens OX=9606 GN=ESX1 PE=1 SV=3
9	Q1LVQ7	8.12e-16	75.9	320	0.195	0.113	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
10	A0A1W2PP27	1.78e-15	73.9	260	0.222	0.158	A0A1W2PP27_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
11	A0A1W2PQ31	1.84e-15	74.3	277	0.222	0.148	A0A1W2PQ31_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
12	A0A1W2PRU4	1.85e-15	73.9	263	0.222	0.156	A0A1W2PRU4_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
13	A0A1W2PNS7	1.94e-15	74.3	281	0.222	0.146	A0A1W2PNS7_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
14	A0A1W2PPH0	1.94e-15	74.3	283	0.222	0.145	A0A1W2PPH0_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
15	A0A1W2PPJ2	2.02e-15	74.3	282	0.222	0.145	A0A1W2PPJ2_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
16	A0A1W2PRA8	2.19e-15	74.3	286	0.222	0.143	A0A1W2PRA8_HUMAN Paired box 6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
17	A6NNA5	3.15e-15	73.6	263	0.178	0.125	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
18	Q8BYH0	3.15e-15	73.6	263	0.178	0.125	DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus OX=10090 GN=Drgx PE=1 SV=2
19	A0A1W2PSB5	4.28e-15	72.4	221	0.205	0.172	A0A1W2PSB5_HUMAN Paired box 6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
20	P21711	4.29e-15	74.3	377	0.173	0.085	MIX1_XENLA Homeobox protein Mix.1 OS=Xenopus laevis OX=8355 GN=mix-a PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	2.4	19.5	Homeobox KN domain
2	PF00046 Homeodomain	8.9e-20	81.6	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295934

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342931	0.880	Pituitary-specific positive transcription factor 1
2	9606.ENSP00000365682	0.779	Transducin-like enhancer protein 1
3	9606.ENSP00000359567	0.750	Transcription factor SOX-3
4	9606.ENSP00000268712	0.694	Nuclear receptor corepressor 1
5	9606.ENSP00000356795	0.682	T-box transcription factor TBX19
6	9606.ENSP00000312554	0.669	Dynein axonemal heavy chain 12
7	9606.ENSP00000320180	0.661	Growth hormone-releasing hormone receptor
8	9606.ENSP00000217270	0.660	Prokineticin receptor 2
9	9606.ENSP00000260653	0.660	Homeobox protein SIX3
10	9606.ENSP00000046087	0.635	Zona pellucida-binding protein 1
11	9606.ENSP00000452871	0.603	Transducin-like enhancer protein 3
12	9606.ENSP00000325868	0.601	Outer dense fiber protein 3
13	9606.ENSP00000323588	0.580	Transcription factor SOX-2
14	9606.ENSP00000321797	0.579	Fibroblast growth factor 8
15	9606.ENSP00000390436	0.526	Zinc finger protein GLI2
16	9606.ENSP00000328596	0.522	Homeobox protein SIX6
17	9606.ENSP00000384092	0.517	Pro-opiomelanocortin
18	9606.ENSP00000256592	0.515	Thyrotropin subunit beta
19	9606.ENSP00000226413	0.509	Gonadotropin-releasing hormone receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.996	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0048856	0.985	anatomical structure development
GO:0032501	0.982	multicellular organismal process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0009889	0.966	regulation of biosynthetic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0007399	0.965	nervous system development
GO:0031326	0.958	regulation of cellular biosynthetic process
GO:0019219	0.958	regulation of nucleobase-containing compound metabolic process
GO:0030900	0.955	forebrain development
GO:0051252	0.952	regulation of RNA metabolic process
GO:0010468	0.935	regulation of gene expression
GO:0006355	0.927	regulation of DNA-templated transcription
GO:0006357	0.882	regulation of transcription by RNA polymerase II
GO:0048519	0.807	negative regulation of biological process
GO:0048523	0.733	negative regulation of cellular process
GO:0045892	0.688	negative regulation of DNA-templated transcription
GO:0035270	0.658	endocrine system development
GO:0009987	0.602	cellular process
GO:0000122	0.601	negative regulation of transcription by RNA polymerase II
GO:0021536	0.596	diencephalon development
GO:0048732	0.586	gland development
GO:0021983	0.383	pituitary gland development
GO:0048518	0.375	positive regulation of biological process
GO:0050896	0.311	response to stimulus
GO:0009653	0.307	anatomical structure morphogenesis
GO:0048522	0.303	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.757	intracellular organelle lumen
GO:0005737	0.718	cytoplasm
GO:0031981	0.354	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]