StarFunc result for job id Q9UBX3

User Input

>input (287 residues)
MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILAL
YSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPA
DLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLS
CYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHC
AVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QZD8	0.966	0.966	5.824E-33	287	0.895	0.895	Q9QZD8.pdb.gz	DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus OX=10090 GN=Slc25a10 PE=1 SV=2
2	AFDB:A0A0S2Z3G3	0.786	0.765	2.310E-31	296	0.997	0.966	A0A0S2Z3G3.pdb.gz	A0A0S2Z3G3_HUMAN Solute carrier family 25 (Mitochondrial carrier dicarboxylate transporter), member 10, isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A10 PE=2 SV=1
3	AFDB:B4DLN1	0.792	0.524	2.054E-27	442	0.885	0.575	B4DLN1.pdb.gz	B4DLN1_HUMAN cDNA FLJ60124, highly similar to Mitochondrial dicarboxylate carrier OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:Q9VDM3	0.918	0.868	1.033E-22	304	0.498	0.470	Q9VDM3.pdb.gz	Q9VDM3_DROME Dicarboxylate carrier 2 OS=Drosophila melanogaster OX=7227 GN=Dic2 PE=2 SV=2
5	AFDB:Q9Y166	0.746	0.763	1.017E-20	280	0.575	0.589	Q9Y166.pdb.gz	Q9Y166_DROME BcDNA.GH02431 OS=Drosophila melanogaster OX=7227 GN=Dic1 PE=1 SV=1
6	AFDB:F6RGN5	0.593	0.424	1.479E-18	406	0.627	0.443	F6RGN5.pdb.gz	F6RGN5_HUMAN Solute carrier family 25 member 10 OS=Homo sapiens OX=9606 GN=SLC25A10 PE=1 SV=1
7	AFDB:A1Z787	0.751	0.751	2.596E-18	287	0.453	0.453	A1Z787.pdb.gz	A1Z787_DROME Dicarboxylate carrier 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Dic3 PE=2 SV=1
8	AFDB:A0A1D8PQ62	0.732	0.686	1.030E-16	309	0.422	0.392	A0A1D8PQ62.pdb.gz	A0A1D8PQ62_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C603390WA PE=3 SV=1
9	AFDB:Q9SB52	0.752	0.698	2.150E-16	313	0.422	0.387	Q9SB52.pdb.gz	PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana OX=3702 GN=PUMP4 PE=2 SV=1
10	AFDB:Q02978	0.743	0.686	3.615E-16	314	0.401	0.366	Q02978.pdb.gz	M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11 PE=1 SV=3
11	PDB:2c3eA	0.572	0.562	7.136E-7	293	0.199	0.195	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
12	PDB:4c9qB	0.620	0.615	8.861E-7	290	0.167	0.166	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:2lckA	0.595	0.581	1.490E-6	297	0.355	0.343	2lckA.pdb.gz
14	PDB:6gciA	0.651	0.642	2.731E-6	292	0.185	0.182	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
15	PDB:7jsjA	0.209	0.152	3.881E-1	468	0.139	0.085	7jsjA.pdb.gz	Structure and inhibition mechanism of the human citrate transporter NaCT.
16	PDB:3kcuA	0.190	0.204	7.760E-1	252	0.105	0.119	3kcuA.pdb.gz	Structure of the formate transporter FocA reveals a pentameric aquaporin-like channel
17	PDB:6wwzR	0.173	0.167	7.760E-1	310	0.150	0.139	6wwzR.pdb.gz
18	PDB:2wsxA	0.154	0.105	8.103E-1	496	0.143	0.083	2wsxA.pdb.gz	Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
19	PDB:5ogeG	0.226	0.220	9.227E-1	306	0.125	0.118	5ogeG.pdb.gz
20	PDB:5w81A	0.148	0.052	1.006	1173	0.157	0.038	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z382	0.0	588	287	1.000	1.000	A0A0S2Z382_HUMAN Solute carrier family 25 member 10 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A10 PE=2 SV=1
2	A0A0S2Z3G3	0.0	580	296	1.000	0.970	A0A0S2Z3G3_HUMAN Solute carrier family 25 (Mitochondrial carrier dicarboxylate transporter), member 10, isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A10 PE=2 SV=1
3	B4DLN1	0.0	518	442	0.878	0.570	B4DLN1_HUMAN cDNA FLJ60124, highly similar to Mitochondrial dicarboxylate carrier OS=Homo sapiens OX=9606 PE=2 SV=1
4	O89035	0.0	536	286	0.889	0.892	DIC_RAT Mitochondrial dicarboxylate carrier OS=Rattus norvegicus OX=10116 GN=Slc25a10 PE=2 SV=1
5	Q9QZD8	0.0	538	287	0.895	0.895	DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus OX=10090 GN=Slc25a10 PE=1 SV=2
6	Q9UBX3	0.0	588	287	1.000	1.000	DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A10 PE=1 SV=2
7	F6RGN5	3.09e-126	367	406	0.638	0.451	F6RGN5_HUMAN Solute carrier family 25 member 10 OS=Homo sapiens OX=9606 GN=SLC25A10 PE=1 SV=1
8	Q9Y166	1.93e-111	325	280	0.575	0.589	Q9Y166_DROME BcDNA.GH02431 OS=Drosophila melanogaster OX=7227 GN=Dic1 PE=1 SV=1
9	Q9VDM3	5.23e-93	279	304	0.498	0.470	Q9VDM3_DROME Dicarboxylate carrier 2 OS=Drosophila melanogaster OX=7227 GN=Dic2 PE=2 SV=2
10	A1Z787	2.28e-85	259	287	0.453	0.453	A1Z787_DROME Dicarboxylate carrier 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Dic3 PE=2 SV=1
11	Q8T406	2.72e-85	259	287	0.453	0.453	Q8T406_DROME AT23463p OS=Drosophila melanogaster OX=7227 GN=Dic3 PE=2 SV=1
12	Q9SB52	3.41e-68	216	313	0.425	0.390	PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana OX=3702 GN=PUMP4 PE=2 SV=1
13	A0A1D8PQ62	1.29e-65	209	309	0.425	0.395	A0A1D8PQ62_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C603390WA PE=3 SV=1
14	Q9CR62	9.80e-65	207	314	0.394	0.360	M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus OX=10090 GN=Slc25a11 PE=1 SV=3
15	Q9VVS1	1.22e-62	201	302	0.376	0.358	Q9VVS1_DROME Dicarboxylate carrier 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Dic4 PE=2 SV=1
16	P90992	1.43e-62	201	306	0.394	0.369	M2OM_CAEEL Mitochondrial 2-oxoglutarate/malate carrier protein OS=Caenorhabditis elegans OX=6239 GN=misc-1 PE=1 SV=2
17	Q02978	2.78e-62	201	314	0.383	0.350	M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11 PE=1 SV=3
18	Q9SJY5	4.99e-62	200	313	0.397	0.364	PUMP5_ARATH Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana OX=3702 GN=PUMP5 PE=2 SV=1
19	P97700	1.87e-61	199	314	0.380	0.347	M2OM_RAT Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus OX=10116 GN=Slc25a11 PE=1 SV=3
20	Q06143	1.57e-59	193	298	0.387	0.372	DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	1.9e-52	186.5	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000015807

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000016688	0.834	annotation not available
2	60711.ENSCSAP00000014797	0.722	Translocase of outer mitochondrial membrane 40 homolog (yeast)
3	60711.ENSCSAP00000015370	0.722	Translocase of outer mitochondrial membrane 40 homolog (yeast)-like
4	60711.ENSCSAP00000002793	0.714	annotation not available
5	60711.ENSCSAP00000004479	0.696	Mitochondrial ribosomal protein L11
6	60711.ENSCSAP00000000987	0.683	Mitochondrial ribosomal protein L58
7	60711.ENSCSAP00000004000	0.677	Mitochondrial ribosomal protein L44
8	60711.ENSCSAP00000001231	0.662	Mitochondrial ribosomal protein L38
9	60711.ENSCSAP00000009271	0.653	Solute carrier family 7 (anionic amino acid transporter), member 13
10	60711.ENSCSAP00000003501	0.650	Formimidoyltransferase cyclodeaminase
11	60711.ENSCSAP00000011550	0.648	Mitochondrial GTPase that mediates the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis. Acts in collaboration with MRRF. GTP hydrolysis follows the ribosome disassembly and probably occurs on the ribosome large subunit. Not involved in the GTP-dependent ribosomal translocation step during translation elongation
12	60711.ENSCSAP00000016449	0.648	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
13	60711.ENSCSAP00000016761	0.611	Solute carrier family 5 (sodium/sugar cotransporter), member 9
14	60711.ENSCSAP00000008974	0.595	NME/NM23 nucleoside diphosphate kinase 4
15	60711.ENSCSAP00000010836	0.592	Rap guanine nucleotide exchange factor (GEF) 4
16	60711.ENSCSAP00000007268	0.587	Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family
17	60711.ENSCSAP00000004675	0.571	Formation of mitochondrial complex V assembly factor 1 homolog
18	60711.ENSCSAP00000007216	0.568	annotation not available
19	60711.ENSCSAP00000003382	0.566	Era-like 12S mitochondrial rRNA chaperone 1
20	60711.ENSCSAP00000016214	0.560	Mitochondrial ribosomal protein L9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005310	0.998	dicarboxylic acid transmembrane transporter activity
GO:0005488	0.971	binding
GO:0015291	0.833	secondary active transmembrane transporter activity
GO:0005515	0.686	protein binding
GO:1901702	0.528	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0044238	0.980	primary metabolic process
GO:0071704	0.979	organic substance metabolic process
GO:1901576	0.954	organic substance biosynthetic process
GO:0044237	0.928	cellular metabolic process
GO:0006810	0.845	transport
GO:0071702	0.831	organic substance transport
GO:0006006	0.723	glucose metabolic process
GO:0015849	0.696	organic acid transport
GO:0046364	0.553	monosaccharide biosynthetic process
GO:0046942	0.491	carboxylic acid transport
GO:0019319	0.423	hexose biosynthetic process
GO:0044249	0.358	cellular biosynthetic process
GO:0006835	0.323	dicarboxylic acid transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.987	membrane
GO:0070013	0.986	intracellular organelle lumen
GO:0031090	0.934	organelle membrane
GO:0031967	0.908	organelle envelope
GO:0005740	0.897	mitochondrial envelope
GO:0031966	0.888	mitochondrial membrane
GO:0005634	0.826	nucleus
GO:0031981	0.810	nuclear lumen
GO:0005654	0.798	nucleoplasm
GO:0019866	0.780	organelle inner membrane
GO:0005743	0.759	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]