StarFunc result for job id Q9UBX8

User Input

>input (382 residues)
MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTI
GHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLN
VNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIP
MLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYY
GCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNR
VHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKIL
VDRLYTNISVNLMPELAPIEDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88419	0.992	0.992	1.054E-81	382	0.942	0.942	O88419.pdb.gz	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1
2	AFDB:F1QGG1	0.947	0.949	6.509E-73	381	0.809	0.811	F1QGG1.pdb.gz
3	AFDB:A0A1S6M251	0.937	0.923	2.942E-67	388	0.712	0.701	A0A1S6M251.pdb.gz	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
4	AFDB:Q3YL68	0.917	0.919	3.142E-64	381	0.665	0.667	Q3YL68.pdb.gz	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
5	AFDB:O60909	0.683	0.701	8.743E-37	372	0.317	0.325	O60909.pdb.gz	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
6	AFDB:A0A384NY44	0.683	0.664	2.496E-36	393	0.330	0.321	A0A384NY44.pdb.gz	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:Q9GUM2	0.682	0.681	5.923E-36	383	0.314	0.313	Q9GUM2.pdb.gz	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
8	AFDB:P15291	0.677	0.650	8.577E-36	398	0.304	0.291	P15291.pdb.gz	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
9	AFDB:P15535	0.682	0.653	8.577E-36	399	0.306	0.293	P15535.pdb.gz	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
10	AFDB:B2RAZ5	0.671	0.743	2.035E-35	344	0.314	0.349	B2RAZ5.pdb.gz	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
11	PDB:4fixA	0.325	0.207	9.666E-6	629	0.084	0.051	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
12	PDB:6pxuB	0.363	0.270	1.214E-4	532	0.092	0.066	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
13	PDB:4d0tA	0.345	0.275	1.553E-4	496	0.086	0.067	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
14	PDB:6h0bB	0.338	0.253	6.423E-4	521	0.060	0.044	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
15	PDB:4decA	0.323	0.413	1.834E-3	284	0.076	0.102	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
16	PDB:4d11C	0.336	0.298	2.497E-3	436	0.084	0.073	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
17	PDB:2d7iA	0.312	0.230	2.825E-3	536	0.092	0.065	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
18	PDB:6iwqA	0.327	0.238	3.004E-3	546	0.097	0.068	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
19	PDB:5mlzA	0.169	0.181	4.922E-3	355	0.055	0.059	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
20	PDB:4y63A	0.279	0.361	5.569E-3	282	0.092	0.124	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1S6M251	0.0	553	388	0.665	0.655	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
2	O43286	0.0	556	388	0.670	0.660	B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B4GALT5 PE=1 SV=1
3	O88419	0.0	770	382	0.942	0.942	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1
4	Q3YL68	0.0	524	381	0.641	0.643	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
5	Q802Y5	0.0	660	381	0.804	0.806	Q802Y5_DANRE Beta-1,4-galactosyltransferase OS=Danio rerio OX=7955 GN=zgc:55730 PE=2 SV=1
6	Q9JMK0	0.0	558	388	0.673	0.662	B4GT5_MOUSE Beta-1,4-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B4galt5 PE=1 SV=2
7	Q9UBX8	0.0	798	382	1.000	1.000	B4GT6_HUMAN Beta-1,4-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B4GALT6 PE=1 SV=1
8	Q9WVK5	0.0	768	382	0.948	0.948	B4GT6_MOUSE Beta-1,4-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B4galt6 PE=1 SV=1
9	P15535	2.83e-73	235	399	0.335	0.321	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
10	Q99PC2	2.09e-72	233	393	0.306	0.298	Q99PC2_CRIGR Beta-1,4-galactosyltransferase OS=Cricetulus griseus OX=10029 GN=beta4GalT-1 PE=2 SV=1
11	A0A384NY44	2.59e-72	233	393	0.312	0.303	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
12	O60512	2.59e-72	233	393	0.312	0.303	B4GT3_HUMAN Beta-1,4-galactosyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALT3 PE=1 SV=2
13	Q9Z2Y2	3.43e-72	231	369	0.346	0.358	B4GT2_MOUSE Beta-1,4-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B4galt2 PE=2 SV=1
14	P08037	4.27e-71	229	402	0.317	0.301	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
15	O60909	9.67e-71	228	372	0.322	0.331	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
16	P15291	2.72e-70	227	398	0.306	0.294	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
17	Q9GUM2	1.21e-69	225	383	0.296	0.295	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
18	Q7KN92	6.47e-64	211	403	0.283	0.268	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
19	B2RAZ5	1.47e-62	206	344	0.296	0.328	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
20	O60513	1.47e-62	206	344	0.296	0.328	B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02709 Glyco_transf_7C	3.5e-26	102.0	N-terminal domain of galactosyltransferase
2	PF13733 Glyco_transf_7N	6.4e-52	186.1	N-terminal region of glycosyl transferase group 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366549	0.971	Lactosylceramide alpha-2,3-sialyltransferase
2	9606.ENSP00000363397	0.965	Ceramide glucosyltransferase
3	9606.ENSP00000384794	0.957	Lactosylceramide 4-alpha-galactosyltransferase
4	9606.ENSP00000341562	0.955	Beta-1,4 N-acetylgalactosaminyltransferase 1
5	9606.ENSP00000367343	0.954	Non-lysosomal glucosylceramidase
6	9606.ENSP00000314508	0.941	Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose . Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes . Through the production of ceramides, participates to the PKC-activated salvage pathway of ceramide formation . Also plays a role in cholesterol metabolism . May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol . The short chain saturated C8: [...]
7	9606.ENSP00000316173	0.933	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
8	9606.ENSP00000169298	0.915	Beta-galactoside alpha-2,6-sialyltransferase 1
9	9606.ENSP00000406861	0.911	Mucin-6
10	9606.ENSP00000387356	0.904	Aggrecan core protein
11	9606.ENSP00000485028	0.904	Mucin-13
12	9606.ENSP00000414350	0.902	Mucin-20
13	9606.ENSP00000416753	0.902	Mucin-15
14	9606.ENSP00000266718	0.901	Lumican
15	9606.ENSP00000441929	0.901	Mucin-12
16	9606.ENSP00000484824	0.901	Mucin-1
17	9606.ENSP00000262551	0.900	Mimecan
18	9606.ENSP00000266719	0.900	Keratocan
19	9606.ENSP00000302716	0.900	Mucin-17
20	9606.ENSP00000311364	0.900	Mucin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0008489	0.945	UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity
GO:0005515	0.815	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0006643	0.995	membrane lipid metabolic process
GO:0006664	0.989	glycolipid metabolic process
GO:0030148	0.986	sphingolipid biosynthetic process
GO:0006687	0.981	glycosphingolipid metabolic process
GO:0009247	0.968	glycolipid biosynthetic process
GO:0006688	0.953	glycosphingolipid biosynthetic process
GO:0006672	0.602	ceramide metabolic process
GO:0046513	0.441	ceramide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005794	1.000	Golgi apparatus
GO:0031090	0.988	organelle membrane
GO:0000139	0.974	Golgi membrane
GO:0043233	0.436	organelle lumen
GO:0070013	0.431	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]