StarFunc result for job id Q9UBZ4

User Input

>input (518 residues)
MLRVVSWNINGIRRPLQGVANQEPSNCAAVAVGRILDELDADIVCLQETKVTRDALTEPL
AIVEGYNSYFSFSRNRSGYSGVATFCKDNATPVAAEEGLSGLFATQNGDVGCYGNMDEFT
QEELRALDSEGRALLTQHKIRTWEGKEKTLTLINVYCPHADPGRPERLVFKMRFYRLLQI
RAEALLAAGSHVIILGDLNTAHRPIDHWDAVNLECFEEDPGRKWMDSLLSNLGCQSASHV
GPFIDSYRCFQPKQEGAFTCWSAVTGARHLNYGSRLDYVLGDRTLVIDTFQASFLLPEVM
GSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSPVLEQSTLQHN
NQTRVQTCQNKAQVRSTRPQPSQVGSSRGQKNLKSYFQPSPSCPQASPDIELPSLPLMSA
LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCGGHREPCVMRT
VKKPGPNLGRRFYMCARPRGPPTDPSSRCNFFLWSRPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KN95	0.689	0.689	3.769E-97	518	1.000	1.000	E5KN95.pdb.gz	E5KN95_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX2 PE=3 SV=1
2	AFDB:Q68G58	0.776	0.779	8.690E-85	516	0.795	0.798	Q68G58.pdb.gz	APEX2_MOUSE DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Mus musculus OX=10090 GN=Apex2 PE=1 SV=1
3	PDB:7cd5A	0.450	0.814	1.560E-19	278	0.154	0.288	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
4	PDB:2o3cB	0.447	0.806	3.122E-18	280	0.162	0.300	2o3cB.pdb.gz
5	PDB:1akoA	0.436	0.810	1.759E-17	268	0.147	0.284	1akoA.pdb.gz
6	PDB:2j63A	0.451	0.681	2.215E-17	333	0.158	0.246	2j63A.pdb.gz
7	PDB:6o1kA	0.439	0.828	7.028E-16	262	0.129	0.256	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
8	PDB:7ax1A	0.354	0.354	5.662E-10	518	0.114	0.114	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
9	PDB:4f1iA	0.336	0.503	4.255E-9	328	0.097	0.152	4f1iA.pdb.gz
10	AFDB:Q12271	0.285	0.151	1.172E-7	1107	0.118	0.055	Q12271.pdb.gz	INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP53 PE=1 SV=1
11	PDB:2a3zB	0.337	0.610	1.801E-7	260	0.085	0.169	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
12	PDB:7kiuA	0.324	0.581	3.395E-7	263	0.098	0.194	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
13	PDB:4awnA	0.334	0.601	4.798E-7	260	0.098	0.196	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
14	AFDB:Q9D2G5	0.301	0.131	1.175E-6	1434	0.164	0.059	Q9D2G5.pdb.gz	SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus OX=10090 GN=Synj2 PE=1 SV=2
15	AFDB:Q92835	0.280	0.141	1.403E-4	1189	0.139	0.061	Q92835.pdb.gz	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2
16	AFDB:A0A1L8HU22	0.086	0.072	6.279E-4	616	0.071	0.060	A0A1L8HU22.pdb.gz	NEIL3_XENLA Endonuclease 8-like 3 OS=Xenopus laevis OX=8355 GN=neil3 PE=1 SV=1
17	AFDB:Q8TAT5	0.087	0.075	1.184E-3	605	0.100	0.086	Q8TAT5.pdb.gz	NEIL3_HUMAN Endonuclease 8-like 3 OS=Homo sapiens OX=9606 GN=NEIL3 PE=1 SV=3
18	AFDB:Q9NG98	0.091	0.043	2.106E-3	1250	0.073	0.030	Q9NG98.pdb.gz	TOP3A_DROME DNA topoisomerase 3-alpha OS=Drosophila melanogaster OX=7227 GN=Top3alpha PE=2 SV=2
19	AFDB:Q8K203	0.084	0.072	2.503E-3	606	0.075	0.064	Q8K203.pdb.gz	NEIL3_MOUSE Endonuclease 8-like 3 OS=Mus musculus OX=10090 GN=Neil3 PE=1 SV=1
20	AFDB:Q9ES52	0.272	0.137	5.942E-3	1191	0.122	0.053	Q9ES52.pdb.gz	SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus OX=10090 GN=Inpp5d PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5KN95	0.0	1075	518	1.000	1.000	E5KN95_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX2 PE=3 SV=1
2	Q68G58	0.0	819	516	0.795	0.798	APEX2_MOUSE DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Mus musculus OX=10090 GN=Apex2 PE=1 SV=1
3	Q9UBZ4	0.0	1075	518	1.000	1.000	APEX2_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Homo sapiens OX=9606 GN=APEX2 PE=1 SV=1
4	P87175	1.44e-59	207	523	0.315	0.312	APN2_SCHPO DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apn2 PE=1 SV=1
5	F4JNY0	1.97e-51	187	610	0.251	0.213	APE2_ARATH DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Arabidopsis thaliana OX=3702 GN=APE2 PE=1 SV=1
6	P38207	1.24e-41	158	520	0.278	0.277	APN2_YEAST DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APN2 PE=1 SV=1
7	P27864	7.39e-24	107	679	0.185	0.141	RRP1_DROME Recombination repair protein 1 OS=Drosophila melanogaster OX=7227 GN=Rrp1 PE=1 SV=2
8	Q57X31	1.13e-23	105	396	0.187	0.245	Q57X31_TRYB2 DNA-(apurinic or apyrimidinic site) endonuclease OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.110 PE=3 SV=1
9	P45951	6.87e-22	101	536	0.164	0.159	ARP_ARATH DNA-(apurinic or apyrimidinic site) endonuclease, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ARP PE=1 SV=2
10	P51173	6.98e-21	96.3	361	0.153	0.219	APEA_DICDI DNA-(apurinic or apyrimidinic site) endonuclease OS=Dictyostelium discoideum OX=44689 GN=apeA PE=2 SV=2
11	P27695	3.14e-18	87.8	318	0.168	0.274	APEX1_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2
12	Q5TZP7	3.14e-18	87.8	318	0.168	0.274	Q5TZP7_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=2 SV=1
13	P28352	3.92e-18	87.4	317	0.170	0.278	APEX1_MOUSE DNA-(apurinic or apyrimidinic site) endonuclease OS=Mus musculus OX=10090 GN=Apex1 PE=1 SV=2
14	P43138	9.09e-18	86.7	317	0.168	0.274	APEX1_RAT DNA-(apurinic or apyrimidinic site) endonuclease OS=Rattus norvegicus OX=10116 GN=Apex1 PE=1 SV=2
15	A0MTA1	1.14e-17	85.9	310	0.166	0.277	APEX1_DANRE DNA-(apurinic or apyrimidinic site) endonuclease OS=Danio rerio OX=7955 GN=apex1 PE=1 SV=1
16	O15922	1.17e-14	78.6	447	0.172	0.199	O15922_LEIMA DNA-(apurinic or apyrimidinic site) endonuclease OS=Leishmania major OX=5664 GN=LmAP PE=1 SV=1
17	P09030	4.80e-12	68.6	268	0.168	0.325	EX3_ECOLI Exodeoxyribonuclease III OS=Escherichia coli (strain K12) OX=83333 GN=xthA PE=1 SV=4
18	Q383L5	6.83e-12	70.1	572	0.141	0.128	Q383L5_TRYB2 DNA-(Apurinic or apyrimidinic site) lyase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2410 PE=3 SV=1
19	G5EBR7	5.21e-09	59.7	288	0.153	0.274	G5EBR7_CAEEL DNA-(apurinic or apyrimidinic site) endonuclease OS=Caenorhabditis elegans OX=6239 GN=exo-3 PE=1 SV=1
20	G3V3M6	3.97e-08	57.0	263	0.108	0.213	G3V3M6_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease (Fragment) OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	1.4e-16	72.4	Endonuclease/Exonuclease/phosphatase family
2	PF14529 Exo_endo_phos_2	13	17.1	Endonuclease-reverse transcriptase
3	PF20406 SAM_KSR1_N	1.2e+02	13.6	Kinase suppressor RAS 1 N-terminal helical hairpin
4	PF06839 zf-GRF	1.3e-09	49.3	GRF zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219066	0.908	Endonuclease III-like protein 1
2	9606.ENSP00000337353	0.899	Tyrosyl-DNA phosphodiesterase 1
3	9606.ENSP00000242576	0.896	Uracil-DNA glycosylase
4	9606.ENSP00000400806	0.894	Aprataxin
5	9606.ENSP00000216714	0.873	DNA-(apurinic or apyrimidinic site) lyase
6	9606.ENSP00000310520	0.846	DNA repair endonuclease XPF
7	9606.ENSP00000323511	0.846	Bifunctional polynucleotide phosphatase/kinase
8	9606.ENSP00000306561	0.834	N-glycosylase/DNA lyase
9	9606.ENSP00000305480	0.832	Flap endonuclease 1
10	9606.ENSP00000264596	0.786	Endonuclease 8-like 3
11	9606.ENSP00000442336	0.776	DNA topoisomerase 3-alpha
12	9606.ENSP00000263274	0.741	DNA ligase 1
13	9606.ENSP00000425809	0.740	Phosphoacetylglucosamine mutase
14	9606.ENSP00000288937	0.726	Mitochondrial ribosomal protein L17
15	9606.ENSP00000368458	0.699	Proliferating cell nuclear antigen
16	9606.ENSP00000013807	0.671	DNA excision repair protein ERCC-1
17	9606.ENSP00000233146	0.663	DNA mismatch repair protein Msh2
18	9606.ENSP00000370013	0.662	Pentatricopeptide repeat-containing protein 2, mitochondrial
19	9606.ENSP00000221486	0.660	Ribonuclease H2 subunit A
20	9606.ENSP00000355506	0.654	Exonuclease 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016787	0.998	hydrolase activity
GO:0016788	0.990	hydrolase activity, acting on ester bonds
GO:0004518	0.980	nuclease activity
GO:0140640	0.970	catalytic activity, acting on a nucleic acid
GO:0140097	0.933	catalytic activity, acting on DNA
GO:0004527	0.823	exonuclease activity
GO:0004536	0.385	deoxyribonuclease activity
GO:0042578	0.345	phosphoric ester hydrolase activity
GO:0016796	0.345	exonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006281	0.996	DNA repair
GO:0006284	0.497	base-excision repair
GO:0065007	0.434	biological regulation
GO:0050789	0.372	regulation of biological process
GO:0050794	0.360	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005737	0.838	cytoplasm
GO:0005730	0.835	nucleolus
GO:0016020	0.681	membrane
GO:0001650	0.546	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.998	Hydrolases.
EC:3.1.-.-	0.990	Acting on ester bonds.
EC:3.1.15.-	0.345	Exonucleases active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters.

[back to server]