StarFunc result for job id Q9UBZ9

User Input

>input (1251 residues)
MRRGGWRKRAENDGWETWGGYMAAKVQKLEEQFRSDAAMQKDGTSSTIFSGVAIYVNGYT
DPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKA
GRLLSYIPYQLYTKQSSVQKGLSFNPVCRPEDPLPGPSNIAKQLNNRVNHIVKKIETENE
VKVNGMNSWNEEDENNDFSFVDLEQTSPGRKQNGIPHPRGSTAIFNGHTPSSNGALKTQD
CLVPMVNSVASRLSPAFSQEEDKAEKSSTDFRDCTLQQLQQSTRNTDALRNPHRTNSFSL
SPLHSNTKINGAHHSTVQGPSSTKSTSSVSTFSKAAPSVPSKPSDCNFISNFYSHSRLHH
ISMWKCELTEFVNTLQRQSNGIFPGREKLKKMKTGRSALVVTDTGDMSVLNSPRHQSCIM
HVDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAA
DIPDSSLWENPDSAQANGIDSVLSRAEIASCSYEARQLGIKNGMFFGHAKQLCPNLQAVP
YDFHAYKEVAQTLYETLASYTHNIEAVSCDEALVDITEILAETKLTPDEFANAVRMEIKD
QTKCAASVGIGSNILLARMATRKAKPDGQYHLKPEEVDDFIRGQLVTNLPGVGHSMESKL
ASLGIKTCGDLQYMTMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSVSAEINYGI
RFTQPKEAEAFLLSLSEEIQRRLEATGMKGKRLTLKIMVRKPGAPVETAKFGGHGICDNI
ARTVTLDQATDNAKIIGKAMLNMFHTMKLNISDMRGVGIHVNQLVPTNLNPSTCPSRPSV
QSSHFPSGSYSVRDVFQVQKAKKSTEEEHKEVFRAAVDLEISSASRTCTFLPPFPAHLPT
SPDTNKAESSGKWNGLHTPVSVQSRLNLSIEVPSPSQLDQSVLEALPPDLREQVEQVCAV
QQAESHGDKKKEPVNGCNTGILPQPVGTVLLQIPEPQESNSDAGINLIALPAFSQVDPEV
FAALPAELQRELKAAYDQRQRQGENSTHQQSASASVPKNPLLHLKAAVKEKKRNKKKKTI
GSPKRIQSPLNNKLLNSPAKTLPGACGSPQKLIDGFLKHEGPPAEKPLEELSASTSGVPG
LSSLQSDPAGCVRPPAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEE
KDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4KWZ7	0.621	0.619	0.000	1255	0.773	0.771	Q4KWZ7.pdb.gz	REV1_CHICK DNA repair protein REV1 OS=Gallus gallus OX=9031 GN=REV1 PE=2 SV=1
2	AFDB:Q920Q2	0.650	0.651	0.000	1249	0.841	0.842	Q920Q2.pdb.gz	REV1_MOUSE DNA repair protein REV1 OS=Mus musculus OX=10090 GN=Rev1 PE=1 SV=1
3	AFDB:Q9UBZ9	1.000	1.000	0.000	1251	1.000	1.000	Q9UBZ9.pdb.gz	REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens OX=9606 GN=REV1 PE=1 SV=1
4	AFDB:A3EWL3	0.336	0.378	9.907E-73	1105	0.258	0.292	A3EWL3.pdb.gz	REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana OX=3702 GN=REV1 PE=2 SV=1
5	AFDB:Q92QM8	0.264	0.737	1.855E-28	430	0.081	0.235	Q92QM8.pdb.gz	DPO41_RHIME DNA polymerase IV 1 OS=Rhizobium meliloti (strain 1021) OX=266834 GN=dinB1 PE=3 SV=1
6	PDB:5c5jF	0.250	0.853	1.745E-27	342	0.087	0.319	5c5jF.pdb.gz	Reactive Oxygen Species Play an Important Role in the Bactericidal Activity of Quinolone Antibiotics
7	AFDB:P9WNT1	0.258	0.881	1.668E-26	346	0.077	0.277	P9WNT1.pdb.gz	DPO42_MYCTU DNA polymerase IV 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dinB2 PE=3 SV=1
8	AFDB:P9WNT3	0.258	0.660	1.855E-26	468	0.082	0.218	P9WNT3.pdb.gz	DPO41_MYCTU DNA polymerase IV 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dinB1 PE=1 SV=1
9	PDB:7nv0A	0.253	0.708	3.469E-23	430	0.088	0.256	7nv0A.pdb.gz	Cryo-EM structure of human Pol kappa bound to DNA and mono-ubiquitylated PCNA.
10	AFDB:Q9ZW89	0.064	0.172	1.345E-4	453	0.045	0.124	Q9ZW89.pdb.gz	Q9ZW89_ARATH RING-type E3 ubiquitin transferase BRCA1 OS=Arabidopsis thaliana OX=3702 GN=At1g67180 PE=4 SV=1
11	AFDB:B3DJX4	0.051	0.052	1.535E-3	1186	0.118	0.125	B3DJX4.pdb.gz
12	AFDB:F7BYT9	0.048	0.048	2.344E-3	1245	0.120	0.120	F7BYT9.pdb.gz	F7BYT9_MACMU Rho guanine nucleotide exchange factor 2 OS=Macaca mulatta OX=9544 GN=ARHGEF2 PE=4 SV=3
13	PDB:7lsyY	0.067	0.094	9.450E-3	855	0.018	0.027	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
14	PDB:7nacn	0.062	0.171	2.090E-2	425	0.019	0.056	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
15	PDB:7ohpn	0.054	0.198	4.624E-2	314	0.019	0.076	7ohpn.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
16	PDB:8dr5A	0.051	0.095	4.624E-2	646	0.014	0.028	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
17	PDB:2p5oD	0.090	0.140	1.333E-1	671	0.030	0.055	2p5oD.pdb.gz	Crystallographic snapshots of a replicative DNA polymerase encountering an abasic site.
18	PDB:6u68A	0.046	0.135	2.146E-1	319	0.017	0.066	6u68A.pdb.gz
19	PDB:7cpxA	0.050	0.032	2.652E-1	2262	0.028	0.015	7cpxA.pdb.gz	Structural basis for the biosynthesis of lovastatin.
20	PDB:6umxA	0.024	0.084	4.747E-1	279	0.009	0.039	6umxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L461	0.0	2599	1250	0.998	0.998	A1L461_HUMAN DNA repair protein REV1 OS=Homo sapiens OX=9606 GN=REV1 PE=2 SV=1
2	Q4KWZ7	0.0	1884	1255	0.772	0.770	REV1_CHICK DNA repair protein REV1 OS=Gallus gallus OX=9031 GN=REV1 PE=2 SV=1
3	Q920Q2	0.0	2178	1249	0.842	0.843	REV1_MOUSE DNA repair protein REV1 OS=Mus musculus OX=10090 GN=Rev1 PE=1 SV=1
4	Q9UBZ9	0.0	2609	1251	1.000	1.000	REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens OX=9606 GN=REV1 PE=1 SV=1
5	Q9W0P2	1.24e-121	403	995	0.174	0.219	REV1_DROME DNA repair protein Rev1 OS=Drosophila melanogaster OX=7227 GN=Rev1 PE=1 SV=1
6	A3EWL3	1.17e-91	322	1105	0.196	0.222	REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana OX=3702 GN=REV1 PE=2 SV=1
7	O94623	7.04e-78	279	935	0.149	0.199	REV1_SCHPO DNA repair protein rev1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rev1 PE=3 SV=3
8	P12689	4.54e-41	167	985	0.114	0.144	REV1_YEAST DNA repair protein REV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REV1 PE=1 SV=2
9	Q47155	1.22e-40	156	351	0.082	0.291	DPO4_ECOLI DNA polymerase IV OS=Escherichia coli (strain K12) OX=83333 GN=dinB PE=1 SV=1
10	Q74CQ6	1.53e-40	157	409	0.100	0.306	Q74CQ6_GEOSL DNA polymerase IV OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=dinB PE=3 SV=1
11	Q4FKQ0	8.77e-40	159	613	0.103	0.210	Q4FKQ0_TRYB2 DNA damage repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2740 PE=4 SV=1
12	Q72MY7	2.20e-37	147	362	0.086	0.298	DPO4_LEPIC DNA polymerase IV OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=dinB PE=3 SV=2
13	Q8Y5T0	1.02e-34	139	356	0.089	0.312	DPO4_LISMO DNA polymerase IV OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=dinB PE=3 SV=1
14	P9WNT3	4.61e-27	118	468	0.060	0.160	DPO41_MYCTU DNA polymerase IV 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dinB1 PE=1 SV=1
15	Q92QM8	6.92e-27	117	430	0.089	0.258	DPO41_RHIME DNA polymerase IV 1 OS=Rhizobium meliloti (strain 1021) OX=266834 GN=dinB1 PE=3 SV=1
16	Q7T2X8	3.37e-23	108	673	0.085	0.158	Q7T2X8_CHICK Polymerase eta OS=Gallus gallus OX=9031 GN=pol eta PE=2 SV=1
17	O74944	2.08e-22	105	547	0.057	0.130	POLK_SCHPO DNA polymerase kappa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug40 PE=1 SV=3
18	Q6JDV7	4.04e-22	105	671	0.079	0.148	POLK_ARATH DNA polymerase kappa OS=Arabidopsis thaliana OX=3702 GN=POLK PE=1 SV=1
19	Q6R3M4	9.89e-21	100	717	0.071	0.124	POLI_MOUSE DNA polymerase iota OS=Mus musculus OX=10090 GN=Poli PE=1 SV=1
20	Q8AWW1	4.35e-19	95.9	867	0.083	0.120	Q8AWW1_CHICK DNA polymerase kappa OS=Gallus gallus OX=9031 GN=DINB1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	0.00034	32.2	BRCA1 C Terminus (BRCT) domain
2	PF16589 BRCT_2	2.2e-06	39.3	BRCT domain, a BRCA1 C-terminus domain
3	PF11731 Cdd1	10	17.8	Pathogenicity locus
4	PF08827 DUF1805	63	15.2	Domain of unknown function (DUF1805)
5	PF00817 IMS	1.2e-38	143.9	impB/mucB/samB family
6	PF11799 IMS_C	7.2e-13	60.4	impB/mucB/samB family C-terminal domain
7	PF11798 IMS_HHH	0.45	22.0	IMS family HHH motif
8	PF16759 LIG3_BRCT	0.088	24.5	DNA ligase 3 BRCT domain
9	PF18182 mCpol	4.3e+02	12.6	minimal CRISPR polymerase domain
10	PF12738 PTCB-BRCT	0.71	21.2	twin BRCT domain
11	PF16727 REV1_C	2.8e-10	51.8	DNA repair protein REV1 C-terminal domain
12	PF18215 Rtt106_N	5e+02	11.7	Histone chaperone Rtt106 N-terminal domain
13	PF14377 UBM	3.4e-05	34.4	Ubiquitin binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258428

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000235310	0.999	Mitotic spindle assembly checkpoint protein MAD2B
2	9606.ENSP00000351697	0.999	DNA polymerase zeta catalytic subunit
3	9606.ENSP00000361310	0.999	DNA polymerase eta
4	9606.ENSP00000263681	0.995	DNA polymerase delta subunit 3
5	9606.ENSP00000241436	0.991	DNA polymerase kappa
6	9606.ENSP00000383710	0.991	Fanconi anemia core complex-associated protein 20
7	9606.ENSP00000359181	0.988	DNA polymerase lambda
8	9606.ENSP00000368458	0.988	Proliferating cell nuclear antigen
9	9606.ENSP00000379174	0.985	DNA-directed DNA/RNA polymerase mu
10	9606.ENSP00000462664	0.980	DNA polymerase iota
11	9606.ENSP00000441543	0.958	Polyubiquitin-C
12	9606.ENSP00000287647	0.942	Fanconi anemia group D2 protein
13	9606.ENSP00000272317	0.940	Ubiquitin-40S ribosomal protein S27a
14	9606.ENSP00000304697	0.938	Polyubiquitin-B
15	9606.ENSP00000264926	0.932	E3 ubiquitin-protein ligase RAD18
16	9606.ENSP00000308944	0.920	Helicase-like transcription factor
17	9606.ENSP00000388107	0.916	Ubiquitin-60S ribosomal protein L40
18	9606.ENSP00000333266	0.905	Ubiquitin-like modifier-activating enzyme 7
19	9606.ENSP00000372088	0.887	DNA repair protein RAD51 homolog 1
20	9606.ENSP00000428209	0.873	Ubiquitin-conjugating enzyme E2 variant 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016779	1.000	nucleotidyltransferase activity
GO:0003676	0.996	nucleic acid binding
GO:0017125	0.993	deoxycytidyl transferase activity
GO:0003684	0.991	damaged DNA binding
GO:0140640	0.779	catalytic activity, acting on a nucleic acid
GO:0140097	0.759	catalytic activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0050896	0.997	response to stimulus
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0006281	0.989	DNA repair
GO:1901576	0.564	organic substance biosynthetic process
GO:0044249	0.564	cellular biosynthetic process
GO:0044271	0.532	cellular nitrogen compound biosynthetic process
GO:0034654	0.394	nucleobase-containing compound biosynthetic process
GO:0009059	0.361	macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0005737	0.673	cytoplasm
GO:0032991	0.431	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.-	1.000	Nucleotidyltransferases.

[back to server]