StarFunc result for job id Q9UD71

User Input

>input (204 residues)
MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGE
GHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREE
DEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSED
QVEDPALSEPGEEPQRPSPSEPGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UD71	1.000	1.000	2.434E-30	204	1.000	1.000	Q9UD71.pdb.gz	PPR1B_HUMAN Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens OX=9606 GN=PPP1R1B PE=1 SV=2
2	AFDB:Q6J4I0	0.560	0.558	1.454E-24	205	0.848	0.844	Q6J4I0.pdb.gz	PPR1B_RAT Protein phosphatase 1 regulatory subunit 1B OS=Rattus norvegicus OX=10116 GN=Ppp1r1b PE=1 SV=1
3	AFDB:P19103	0.236	0.273	1.126E-4	171	0.265	0.316	P19103.pdb.gz	PPR1A_RAT Protein phosphatase 1 regulatory subunit 1A OS=Rattus norvegicus OX=10116 GN=Ppp1r1a PE=1 SV=1
4	AFDB:A0A2R8RXX2	0.117	0.050	8.955E-1	635	0.127	0.041	A0A2R8RXX2.pdb.gz
5	AFDB:X1WCM8	0.101	0.032	1.100	933	0.181	0.040	X1WCM8.pdb.gz	X1WCM8_DANRE ATP-dependent DNA helicase OS=Danio rerio OX=7955 GN=recql5 PE=3 SV=1
6	AFDB:Q06787	0.124	0.056	1.447	632	0.186	0.060	Q06787.pdb.gz	FMR1_HUMAN Fragile X messenger ribonucleoprotein 1 OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1
7	AFDB:Q38BB5	0.123	0.068	1.447	392	0.113	0.059	Q38BB5.pdb.gz	Q38BB5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2340 PE=4 SV=1
8	AFDB:Q38847	0.096	0.076	1.660	268	0.127	0.097	Q38847.pdb.gz	AGL15_ARATH Agamous-like MADS-box protein AGL15 OS=Arabidopsis thaliana OX=3702 GN=AGL15 PE=1 SV=1
9	AFDB:Q9U229	0.127	0.045	1.660	700	0.142	0.041	Q9U229.pdb.gz	Q9U229_CAEEL Pyr_redox_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wah-1 PE=1 SV=2
10	PDB:7btbm	0.109	0.058	1.712	469	0.098	0.043	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
11	AFDB:O64647	0.110	0.075	1.904	356	0.181	0.104	O64647.pdb.gz	TCP9_ARATH Transcription factor TCP9 OS=Arabidopsis thaliana OX=3702 GN=TCP9 PE=1 SV=1
12	PDB:6i9r6	0.133	0.086	7.225	354	0.074	0.042	6i9r6.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
13	PDB:7mq9SI	0.103	0.030	8.287	844	0.083	0.020	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7odrl	0.115	0.273	8.875	82	0.064	0.159	7odrl.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UD71	6.69e-144	400	204	1.000	1.000	PPR1B_HUMAN Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens OX=9606 GN=PPP1R1B PE=1 SV=2
2	P07516	1.46e-115	329	202	0.912	0.921	PPR1B_BOVIN Protein phosphatase 1 regulatory subunit 1B OS=Bos taurus OX=9913 GN=PPP1R1B PE=1 SV=1
3	Q60829	1.02e-101	293	194	0.819	0.861	PPR1B_MOUSE Protein phosphatase 1 regulatory subunit 1B OS=Mus musculus OX=10090 GN=Ppp1r1b PE=1 SV=2
4	Q6J4I0	3.20e-96	280	205	0.848	0.844	PPR1B_RAT Protein phosphatase 1 regulatory subunit 1B OS=Rattus norvegicus OX=10116 GN=Ppp1r1b PE=1 SV=1
5	Q8WVI7	5.58e-13	64.7	109	0.176	0.330	PPR1C_HUMAN Protein phosphatase 1 regulatory subunit 1C OS=Homo sapiens OX=9606 GN=PPP1R1C PE=1 SV=1
6	Q13522	5.85e-09	55.5	171	0.211	0.251	PPR1A_HUMAN Protein phosphatase 1 regulatory subunit 1A OS=Homo sapiens OX=9606 GN=PPP1R1A PE=1 SV=3
7	Q9ERT9	3.61e-08	53.1	171	0.167	0.199	PPR1A_MOUSE Protein phosphatase 1 regulatory subunit 1A OS=Mus musculus OX=10090 GN=Ppp1r1a PE=1 SV=1
8	P19103	7.87e-08	52.4	171	0.167	0.199	PPR1A_RAT Protein phosphatase 1 regulatory subunit 1A OS=Rattus norvegicus OX=10116 GN=Ppp1r1a PE=1 SV=1
9	P01099	1.35e-07	51.6	166	0.176	0.217	PPR1A_RABIT Protein phosphatase 1 regulatory subunit 1A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R1A PE=1 SV=1
10	Q9L7Q2	0.76	33.1	1906	0.211	0.023	ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2
11	Q8I4Z1	2.0	32.0	1846	0.083	0.009	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
12	P50079	6.4	30.0	448	0.103	0.047	HSV2_YEAST SVP1-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSV2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04889 Cwf_Cwc_15	1.3e+02	13.8	Cwf15/Cwc15 cell cycle control protein
2	PF05395 DARPP-32	3e-59	211.3	Protein phosphatase inhibitor 1/DARPP-32
3	PF04147 Nop14	6.6e+02	9.9	Nop14-like family
4	PF09184 PPP4R2	2e+02	13.0	PPP4R2
5	PF11705 RNA_pol_3_Rpc31	2e+02	13.4	DNA-directed RNA polymerase III subunit Rpc31

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254079

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326031	0.993	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
2	9606.ENSP00000419782	0.975	Cyclin-dependent-like kinase 5
3	9606.ENSP00000417963	0.944	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
4	9606.ENSP00000365042	0.941	Casein kinase II subunit beta
5	9606.ENSP00000234310	0.931	Calcineurin subunit B type 1
6	9606.ENSP00000324804	0.929	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
7	9606.ENSP00000378323	0.929	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
8	9606.ENSP00000265717	0.926	cAMP-dependent protein kinase type II-beta regulatory subunit
9	9606.ENSP00000318486	0.926	Cyclin-dependent kinase 5 activator 1
10	9606.ENSP00000341779	0.925	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
11	9606.ENSP00000380878	0.919	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
12	9606.ENSP00000418447	0.918	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
13	9606.ENSP00000332116	0.917	cAMP-specific 3',5'-cyclic phosphodiesterase 4B
14	9606.ENSP00000385749	0.911	cAMP-dependent protein kinase type I-beta regulatory subunit
15	9606.ENSP00000265563	0.910	cAMP-dependent protein kinase type II-alpha regulatory subunit
16	9606.ENSP00000378306	0.910	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
17	9606.ENSP00000366488	0.909	cAMP-dependent protein kinase catalytic subunit gamma
18	9606.ENSP00000324464	0.907	Casein kinase I isoform delta
19	9606.ENSP00000359719	0.907	cAMP-dependent protein kinase catalytic subunit beta
20	9606.ENSP00000376475	0.903	cAMP-dependent protein kinase type I-alpha regulatory subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004864	1.000	protein phosphatase inhibitor activity
GO:0004860	0.787	protein kinase inhibitor activity
GO:0004862	0.778	cAMP-dependent protein kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0007154	0.967	cell communication
GO:0051716	0.963	cellular response to stimulus
GO:0065009	0.962	regulation of molecular function
GO:0032501	0.959	multicellular organismal process
GO:0051171	0.955	regulation of nitrogen compound metabolic process
GO:0031323	0.954	regulation of cellular metabolic process
GO:0023052	0.953	signaling
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0019220	0.936	regulation of phosphate metabolic process
GO:0080090	0.922	regulation of primary metabolic process
GO:0048523	0.921	negative regulation of cellular process
GO:0007165	0.915	signal transduction
GO:0042221	0.907	response to chemical
GO:0009892	0.866	negative regulation of metabolic process
GO:0031399	0.863	regulation of protein modification process
GO:0050790	0.860	regulation of catalytic activity
GO:0010033	0.824	response to organic substance
GO:0003008	0.797	system process
GO:0010243	0.790	response to organonitrogen compound
GO:0051172	0.784	negative regulation of nitrogen compound metabolic process
GO:0010563	0.782	negative regulation of phosphorus metabolic process
GO:0044092	0.778	negative regulation of molecular function
GO:0043086	0.764	negative regulation of catalytic activity
GO:0045936	0.761	negative regulation of phosphate metabolic process
GO:0043279	0.754	response to alkaloid
GO:0007611	0.752	learning or memory
GO:0031400	0.738	negative regulation of protein modification process
GO:0035303	0.708	regulation of dephosphorylation
GO:1902074	0.707	response to salt
GO:0010921	0.663	regulation of phosphatase activity
GO:0035305	0.645	negative regulation of dephosphorylation
GO:0035304	0.637	regulation of protein dephosphorylation
GO:0051346	0.627	negative regulation of hydrolase activity
GO:0010923	0.563	negative regulation of phosphatase activity
GO:0071704	0.552	organic substance metabolic process
GO:0044237	0.530	cellular metabolic process
GO:0043666	0.503	regulation of phosphoprotein phosphatase activity
GO:0006807	0.490	nitrogen compound metabolic process
GO:0035308	0.489	negative regulation of protein dephosphorylation
GO:1901700	0.388	response to oxygen-containing compound
GO:0014070	0.380	response to organic cyclic compound
GO:0044238	0.335	primary metabolic process
GO:0048518	0.304	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.988	cytosol
GO:0043226	0.981	organelle
GO:0043227	0.971	membrane-bounded organelle
GO:0043229	0.969	intracellular organelle
GO:0005634	0.960	nucleus
GO:0071944	0.915	cell periphery
GO:0005886	0.906	plasma membrane
GO:0042995	0.817	cell projection
GO:0120025	0.814	plasma membrane bounded cell projection
GO:0043005	0.582	neuron projection
GO:0036477	0.449	somatodendritic compartment
GO:0031981	0.445	nuclear lumen
GO:0032991	0.414	protein-containing complex
GO:0005654	0.381	nucleoplasm
GO:0044297	0.357	cell body
GO:0043025	0.350	neuronal cell body
GO:0030425	0.319	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]