StarFunc result for job id Q9UDT6

User Input

>input (1046 residues)
MQKPSGLKPPGRGGKHSSPMGRTSTGSASSSAAVAASSKEGSPLHKQSSGPSSSPAAAAA
PEKPGPKAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKN
DGAVGGVRYFECPALQGIFTRPSKLTRQPTAEGSGSDAHSVESLTAQNLSLHSGTATPPL
TSRVIPLRESVLNSSVKTGNESGSNLSDSGSVKRGEKDLRLGDRVLVGGTKTGVVRYVGE
TDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKK
TKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEA
LKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLL
VESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLETQTQLEHARIGELEQSLLLE
KAQAERLLRELADNRLTTVAEKSRVLQLEEELTLRRGEIEELQQCLLHSGPPPPDHPDAA
EILRLRERLLSASKEHQRESGVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQ
QATSENMGLMDNWKSKLDSLASDHQKSLEDLKATLNSGPGAQQKEIGELKAVMEGIKMEH
QLELGNLQAKHDLETAMHVKEKEALREKLQEAQEELAGLQRHWRAQLEVQASQHRLELQE
AQDQRRDAELRVHELEKLDVEYRGQAQAIEFLKEQISLAEKKMLDYERLQRAEAQGKQEV
ESLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIRTKETVEGLQDKLNKRDKEVT
ALTSQTEMLRAQVSALESKCKSGEKKVDALLKEKRRLEAELETVSRKTHDASGQLVLISQ
ELLRKERSLNELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDIRGLREKLTGL
DKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDK
AQTIGNSGSANGIHQQDKAQKQEDKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z0H8	0.401	0.401	0.000	1047	0.916	0.915	Q9Z0H8.pdb.gz	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
2	AFDB:Q922J3	0.176	0.141	1.987E-59	1391	0.435	0.327	Q922J3.pdb.gz	CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1
3	AFDB:P30622	0.152	0.114	1.156E-58	1438	0.450	0.328	P30622.pdb.gz	CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2
4	AFDB:Q9JK25	0.233	0.193	5.275E-58	1320	0.427	0.339	Q9JK25.pdb.gz	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
5	AFDB:E7F2X0	0.174	0.126	4.527E-52	1569	0.418	0.279	E7F2X0.pdb.gz	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
6	AFDB:Q9VJE5	0.123	0.082	1.266E-27	1690	0.263	0.163	Q9VJE5.pdb.gz	CL190_DROME Restin homolog OS=Drosophila melanogaster OX=7227 GN=CLIP-190 PE=1 SV=1
7	AFDB:Q8N3C7	0.091	0.129	7.624E-20	705	0.087	0.129	Q8N3C7.pdb.gz	CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
8	AFDB:P13496	0.076	0.064	2.204E-13	1265	0.145	0.120	P13496.pdb.gz	DCTN1_DROME Dynactin subunit 1 OS=Drosophila melanogaster OX=7227 GN=DCTN1-p150 PE=1 SV=2
9	AFDB:E2JKZ0	0.090	0.071	1.363E-12	1351	0.147	0.114	E2JKZ0.pdb.gz	E2JKZ0_CAEEL Dynactin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dnc-1 PE=1 SV=1
10	AFDB:Q54VD6	0.064	0.045	1.219E-10	1539	0.125	0.085	Q54VD6.pdb.gz	Q54VD6_DICDI Dynactin 150 kDa subunit OS=Dictyostelium discoideum OX=44689 GN=dynA PE=3 SV=1
11	PDB:3j791	0.048	0.324	3.368E-2	140	0.013	0.100	3j791.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
12	PDB:6acaA	0.041	0.038	1.446E-1	1133	0.011	0.011	6acaA.pdb.gz
13	PDB:4zn3A	0.048	0.290	1.736E-1	147	0.010	0.068	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
14	PDB:7oydt	0.035	0.196	2.082E-1	126	0.009	0.071	7oydt.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.
15	PDB:5dlqF	0.036	0.194	3.385E-1	138	0.010	0.072	5dlqF.pdb.gz	Structure of the exportin Xpo4 in complex with RanGTP and the hypusine-containing translation factor eIF5A.
16	PDB:7cpuLZ	0.047	0.327	4.061E-1	135	0.013	0.104	7cpuLZ.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
17	PDB:2eyqA	0.042	0.039	4.872E-1	1146	0.011	0.010	2eyqA.pdb.gz
18	PDB:3hksA	0.034	0.172	5.177E-1	144	0.010	0.069	3hksA.pdb.gz
19	PDB:4v8mBU	0.036	0.161	5.846E-1	158	0.018	0.120	4v8mBU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
20	PDB:5gakq	0.037	0.185	7.920E-1	154	0.009	0.058	5gakq.pdb.gz	Structure of the hypusinylated eukaryotic translation factor eIF-5A bound to the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F2X0	0.0	661	1569	0.397	0.264	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
2	O55156	0.0	1855	1046	0.911	0.911	CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus OX=10116 GN=Clip2 PE=1 SV=1
3	P30622	0.0	764	1438	0.462	0.336	CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2
4	Q922J3	0.0	693	1391	0.414	0.311	CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1
5	Q9JK25	0.0	695	1320	0.376	0.298	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
6	Q9UDT6	0.0	2108	1046	1.000	1.000	CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2 PE=1 SV=1
7	Q9Z0H8	0.0	1874	1047	0.912	0.911	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
8	Q9VJE5	3.27e-67	249	1690	0.162	0.100	CL190_DROME Restin homolog OS=Drosophila melanogaster OX=7227 GN=CLIP-190 PE=1 SV=1
9	Q96DZ5	1.27e-43	169	547	0.093	0.177	CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens OX=9606 GN=CLIP3 PE=1 SV=3
10	B9EHT4	2.49e-40	159	547	0.092	0.176	CLIP3_MOUSE CAP-Gly domain-containing linker protein 3 OS=Mus musculus OX=10090 GN=Clip3 PE=1 SV=1
11	B5MCH3	1.03e-36	149	571	0.084	0.154	B5MCH3_HUMAN CAP-Gly domain containing linker protein family member 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
12	Q8N3C7	3.92e-35	145	705	0.084	0.125	CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
13	E9Q309	1.02e-21	104	3095	0.058	0.020	CE350_MOUSE Centrosome-associated protein 350 OS=Mus musculus OX=10090 GN=Cep350 PE=1 SV=1
14	Q5VT06	4.47e-20	99.4	3117	0.051	0.017	CE350_HUMAN Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1
15	E9Q4K7	7.51e-18	92.0	1843	0.039	0.022	E9Q4K7_MOUSE Kinesin family member 13B OS=Mus musculus OX=10090 GN=Kif13b PE=1 SV=1
16	A0A0G2K8Z9	9.49e-18	91.7	1815	0.037	0.021	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
17	Q9NQT8	3.47e-17	89.7	1826	0.040	0.023	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
18	O01349	2.14e-15	84.0	1921	0.033	0.018	O01349_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=2 SV=1
19	A0A0B4KG24	3.46e-15	83.6	1908	0.033	0.018	A0A0B4KG24_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
20	A1ZA18	3.56e-15	83.2	1921	0.033	0.018	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01302 CAP_GLY	9.5e-45	161.7	CAP-Gly domain
2	PF09368 Sas10	1.4e+02	14.4	Sas10 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000223398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417518	0.943	CLIP-associating protein 2
2	9606.ENSP00000263710	0.925	CLIP-associating protein 1
3	9606.ENSP00000221455	0.803	CLK4-associating serine/arginine rich protein
4	9606.ENSP00000300249	0.790	Microtubule-associated protein RP/EB family member 2
5	9606.ENSP00000233121	0.778	Microtubule-associated protein RP/EB family member 3
6	9606.ENSP00000432768	0.772	Cytoskeleton-associated protein 5
7	9606.ENSP00000265753	0.748	Eukaryotic translation initiation factor 4H
8	9606.ENSP00000397566	0.731	General transcription factor II-I repeat domain-containing protein 1
9	9606.ENSP00000364721	0.691	Microtubule-associated protein RP/EB family member 1
10	9606.ENSP00000460070	0.688	General transcription factor II-I
11	9606.ENSP00000336740	0.687	LIM domain kinase 1
12	9606.ENSP00000380378	0.664	Platelet-activating factor acetylhydrolase IB subunit alpha
13	9606.ENSP00000264313	0.631	SLAIN motif-containing protein 2
14	9606.ENSP00000307260	0.617	Transducin beta-like protein 2
15	9606.ENSP00000055077	0.603	Replication factor C subunit 2
16	9606.ENSP00000411073	0.587	B-cell CLL/lymphoma 7 protein family member B
17	9606.ENSP00000222812	0.585	Syntaxin-1A
18	9606.ENSP00000309126	0.573	Probable 28S rRNA (cytosine-C(5))-methyltransferase
19	9606.ENSP00000233336	0.564	Tubulin--tyrosine ligase
20	9606.ENSP00000408910	0.564	Dynactin subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051010	1.000	microtubule plus-end binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0051128	0.958	regulation of cellular component organization
GO:0048522	0.917	positive regulation of cellular process
GO:0016043	0.915	cellular component organization
GO:0051130	0.584	positive regulation of cellular component organization
GO:0006996	0.506	organelle organization
GO:0051179	0.397	localization
GO:0007017	0.371	microtubule-based process
GO:0051493	0.336	regulation of cytoskeleton organization
GO:0007010	0.334	cytoskeleton organization
GO:0051234	0.325	establishment of localization
GO:0051641	0.318	cellular localization
GO:0044087	0.317	regulation of cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	1.000	microtubule cytoskeleton
GO:0032991	0.995	protein-containing complex
GO:0043227	0.988	membrane-bounded organelle
GO:0005737	0.985	cytoplasm
GO:0005874	0.982	microtubule
GO:0005829	0.953	cytosol
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0012505	0.851	endomembrane system
GO:0035371	0.662	microtubule plus-end
GO:0031982	0.411	vesicle
GO:0005634	0.396	nucleus
GO:0070013	0.346	intracellular organelle lumen
GO:0005875	0.342	microtubule associated complex
GO:0031981	0.341	nuclear lumen
GO:0005654	0.320	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]